Bioactive grade

Recombinant human CD86 protein (Active) (Biotin) (ab246058)

Description

  • Product name

    Recombinant human CD86 protein (Active) (Biotin)
    See all CD86 proteins and peptides
  • Biological activity

    Immobilized human CTLA-4, Fc Tag at 10 μg/mL (100 μL/well) can bind ab246058 with a linear range of 0.01-0.15 μg/mL (QC tested).

  • Purity

    > 90 % SDS-PAGE.
    The biotin to protein ratio is 0.5-1 as determined by the HABA assay.
  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    HEK 293 cells
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      LKIQAYFNETADLPCQFANSQNQSLSELVVFWQDQENLVLNEVYLGKEKF DSVHSKYMGRTSFDSDSWTLRLHNLQIKDKGLYQCIIHHKKPTGMIRIHQ MNSELSVLANFSQPEIVPISNITENVYINLTCSSIHGYPEPKKMSVLLRT KNSTIEYDGVMQKSQDNVTELYDVSISLSVSFPDVTSNMTIFCILETDKT RLLSSPFSIELEDPQPPPDHIP
    • Predicted molecular weight

      28 kDa including tags
    • Amino acids

      26 to 247
    • Tags

      His tag C-Terminus , Avi tag C-Terminus
    • Additional sequence information

      Biotinylation of this product is performed using Avitag™ technology. Briefly, the single lysine residue in the Avitag is enzymatically labeled with biotin. Avitag™ sequence GLNDIFEAQKIEWHE.
  • Conjugation

    Biotin

Specifications

Our Abpromise guarantee covers the use of ab246058 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Functional Studies

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon reconsitution add a carrier protein (0.1% BSA). Store at -20°C or -80°C. Avoid freeze / thaw cycle. Store In the Dark.

    pH: 7.40
    Constituents: PBS, 5% Trehalose

    0.22 µm filtered

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    It is recommended to reconstitute the lyophilized product in sterile deionized water to a final concentration of 1 mg/ml. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long term storage.

General Info

  • Alternative names

    • Activation B7-2 antigen
    • Activation B7-2 antigen 3
    • B-lymphocyte activation antigen B7-2
    • B-lymphocyte activation antigen B7-2 2
    • B7
    • B7 2
    • B7-2
    • B7.2
    • B70
    • B72
    • B72 antigen
    • BU63
    • CD28 antigen ligand 2
    • CD28 antigen ligand 2 2
    • Cd28l2
    • CD28LG2
    • CD86
    • CD86 antigen
    • CD86 antigen (CD28 antigen ligand 2 B7 2 antigen)
    • CD86 antigen (CD28 antigen ligand 2, B7-2 antigen)
    • CD86 antigen (CD28 antigen ligand 2, B7-2 antigen) 1, 2
    • CD86 molecule
    • CD86_HUMAN
    • CLS1
    • CTLA-4 counter-receptor B7.2
    • CTLA-4 counter-receptor B7.2 2
    • CTLA-4 counter-receptor B7.2 2, 3
    • Early T-cell costimulatory molecule 1
    • ETC-1
    • FUN 1
    • FUN-1
    • FUN1
    • LAB72
    • Ly-58
    • Ly58
    • MB7
    • MB7-2
    • Membrane glycoprotein
    • MGC34413
    • T lymphocyte activation antigen CD86 precursor
    • T-lymphocyte activation antigen CD86
    • TS/A-2
    see all
  • Function

    Receptor involved in the costimulatory signal essential for T-lymphocyte proliferation and interleukin-2 production, by binding CD28 or CTLA-4. May play a critical role in the early events of T-cell activation and costimulation of naive T-cells, such as deciding between immunity and anergy that is made by T-cells within 24 hours after activation. Isoform 2 interferes with the formation of CD86 clusters, and thus acts as a negative regulator of T-cell activation.
  • Tissue specificity

    Expressed by activated B-lymphocytes and monocytes.
  • Sequence similarities

    Contains 1 Ig-like C2-type (immunoglobulin-like) domain.
    Contains 1 Ig-like V-type (immunoglobulin-like) domain.
  • Post-translational
    modifications

    Polyubiquitinated; which is promoted by MARCH8 and results in endocytosis and lysosomal degradation.
  • Cellular localization

    Membrane.
  • Information by UniProt

Images

  • Immobilized human CTLA-4, Fc Tag at 10 μg/mL (100 μL/well) can bind ab246058 with a linear range of 0.01-0.15 μg/mL (QC tested).

  • SDS-PAGE - Recombinant human CD86 protein (Active) (Biotin) (ab246058).

    The gel was stained overnight with Coomassie Blue. The purity of the protein is greater than 90%. The protein migrates as 45-65 kDa under reducing conditions (SDS-PAGE) due to glycosylation.

References

ab246058 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab246058.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up