Recombinant Human CD9 protein (BSA and azide free) (ab174040)

Description

  • Product name

    Recombinant Human CD9 protein (BSA and azide free)
    See all CD9 proteins and peptides
  • Purity

    > 95 % SDS-PAGE.

  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    HEK 293 cells
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      SHKDEVIKEVQEFYKDTYNKLKTKDEPQRETLKAIHYALNCCGLAGGVEQ FISDICPKKDVLETFTVKSCPDAIKEVFDNKFHI
    • Predicted molecular weight

      11 kDa including tags
    • Amino acids

      112 to 195
    • Tags

      His tag C-Terminus
    • Additional sequence information

      (NP_001760.1)

Specifications

Our Abpromise guarantee covers the use of ab174040 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Lyophilised
  • Additional notes

    Lyophilized from 0.22 µm filtered solution.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at 4°C prior to reconstitution. Store at -20°C or -80°C.

  • Reconstitution
    It is recommended to reconstitute the lyophilized protein in 20 µl sterile deionized water to a final concentration of 1 mg/ml. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long term storage. After reconstitution store under sterile conditions for 1 month at 4°C - 8°C or 3 months at -20°C to -80°C.

General Info

  • Alternative names

    • Tetraspanin 29
    • 5H9
    • 5H9 antigen
    • Antigen defined by monoclonal antibody 602 29
    • Antigen defined by monoclonal antibody 60229
    • BA-2/p24 antigen
    • BA2
    • BTCC 1
    • BTCC1
    • CD9
    • CD9 antigen
    • CD9 antigen p24
    • CD9 molecule
    • CD9_HUMAN
    • Cell growth inhibiting gene 2 protein
    • Cell growth-inhibiting gene 2 protein
    • DRAP 27
    • DRAP27
    • GIG2
    • Growth inhibiting gene 2 protein
    • Leukocyte antigen MIC3
    • MIC3
    • Motility related protein
    • Motility-related protein
    • MRP 1
    • MRP-1
    • MRP1
    • p24
    • p24 antigen
    • Tetraspanin-29
    • Tspan 29
    • Tspan-29
    • TSPAN29
    see all
  • Function

    Involved in platelet activation and aggregation. Regulates paranodal junction formation. Involved in cell adhesion, cell motility and tumor metastasis. Required for sperm-egg fusion.
  • Tissue specificity

    Expressed by a variety of hematopoietic and epithelial cells.
  • Sequence similarities

    Belongs to the tetraspanin (TM4SF) family.
  • Post-translational
    modifications

    Protein exists in three forms with molecular masses between 22 and 27 kDa, and is known to carry covalently linked fatty acids.
  • Cellular localization

    Membrane.
  • Information by UniProt

Images

  • SDS-PAGE analysis of Human CD9 in reducing conditions. Gel stained overnight with Coomassie Blue. Protein migrates at 11 kDa.

References

ab174040 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab174040.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up