Recombinant Human CD9 protein (BSA and azide free) (ab174040)

Overview

Description

  • Nature
    Recombinant
  • Source
    HEK 293 cells
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      SHKDEVIKEVQEFYKDTYNKLKTKDEPQRETLKAIHYALNCCGLAGGVEQ FISDICPKKDVLETFTVKSCPDAIKEVFDNKFHI
    • Molecular weight
      11 kDa including tags
    • Amino acids
      112 to 195
    • Tags
      His tag C-Terminus
    • Additional sequence information
      (NP_001760.1)

Specifications

Our Abpromise guarantee covers the use of ab174040 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Endotoxin level
    < 1.000 Eu/µg
  • Purity
    >95% by SDS-PAGE .

  • Form
    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at 4°C prior to reconstitution. Store at -20°C or -80°C.

General Info

  • Alternative names
    • Tetraspanin 29
    • 5H9
    • 5H9 antigen
    • Antigen defined by monoclonal antibody 602 29
    • Antigen defined by monoclonal antibody 60229
    • BA-2/p24 antigen
    • BA2
    • BTCC 1
    • BTCC1
    • CD9
    • CD9 antigen
    • CD9 antigen p24
    • CD9 molecule
    • CD9_HUMAN
    • Cell growth inhibiting gene 2 protein
    • Cell growth-inhibiting gene 2 protein
    • DRAP 27
    • DRAP27
    • GIG2
    • Growth inhibiting gene 2 protein
    • Leukocyte antigen MIC3
    • MIC3
    • Motility related protein
    • Motility-related protein
    • MRP 1
    • MRP-1
    • MRP1
    • p24
    • p24 antigen
    • Tetraspanin-29
    • Tspan 29
    • Tspan-29
    • TSPAN29
    see all
  • Function
    Involved in platelet activation and aggregation. Regulates paranodal junction formation. Involved in cell adhesion, cell motility and tumor metastasis. Required for sperm-egg fusion.
  • Tissue specificity
    Expressed by a variety of hematopoietic and epithelial cells.
  • Sequence similarities
    Belongs to the tetraspanin (TM4SF) family.
  • Post-translational
    modifications
    Protein exists in three forms with molecular masses between 22 and 27 kDa, and is known to carry covalently linked fatty acids.
  • Cellular localization
    Membrane.
  • Information by UniProt

Images

  • SDS-PAGE analysis of Human CD9 in reducing conditions. Gel stained overnight with Coomassie Blue. Protein migrates at 11 kDa.

References

ab174040 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab174040.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up