Description

  • Product name

    Recombinant Human CD90 / Thy1 protein (His tag)
    See all CD90 / Thy1 proteins and peptides
  • Purity

    > 95 % SDS-PAGE.
    ab222349 was purified using conventional chromatography techniques.
  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    Baculovirus infected insect cells
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      QKVTSLTACLVDQSLRLDCRHENTSSSPIQYEFSLTRETKKHVLFGTVGV PEHTYRSRTNFTSKYNMKVLYLSAFTSKDEGTYTCALHHSGHSPPISSQN VTVLRDKLVKCHHHHHH
    • Predicted molecular weight

      13 kDa including tags
    • Amino acids

      20 to 130
    • Tags

      His tag C-Terminus
    • Additional sequence information

      This product is the mature full length protein from aa 20 to 130. The signal peptide and propeptide are not included (NP_006279).

Specifications

Our Abpromise guarantee covers the use of ab222349 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituents: 10% Glycerol, PBS

General Info

  • Alternative names

    • CD7
    • CD90
    • CD90 antigen
    • CDw90
    • FLJ33325
    • MGC128895
    • T25
    • Theta antigen
    • Thy 1
    • Thy 1 cell surface antigen
    • Thy 1 membrane glycoprotein
    • Thy 1 T cell antigen
    • Thy 1.2
    • Thy-1 antigen
    • Thy-1 membrane glycoprotein
    • Thy1
    • Thy1 antigen
    • Thy1 T cell antigen
    • Thy1.1
    • Thy1.2
    • THY1_HUMAN
    • Thymus cell antigen 1, theta
    see all
  • Function

    May play a role in cell-cell or cell-ligand interactions during synaptogenesis and other events in the brain.
  • Sequence similarities

    Contains 1 Ig-like V-type (immunoglobulin-like) domain.
  • Cellular localization

    Cell membrane.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3 µg ab222349.

    MWt 13.5-28 kDa (SDS–PAGE under reducing conditions).

References

ab222349 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab222349.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up