Recombinant Human CD90 / Thy1 protein (Fc Chimera) (ab157072)
Key features and details
- Expression system: HEK 293 cells
- Purity: > 90% SDS-PAGE
- Endotoxin level: < 0.100 Eu/µg
- Suitable for: SDS-PAGE
Description
-
Product name
Recombinant Human CD90 / Thy1 protein (Fc Chimera)
See all CD90 / Thy1 proteins and peptides -
Biological activity
Binds to Human avß3 integrin. -
Purity
> 90 % SDS-PAGE. -
Endotoxin level
< 0.100 Eu/µg -
Expression system
HEK 293 cells -
Accession
-
Protein length
Full length protein -
Animal free
No -
Nature
Recombinant -
-
Species
Human -
Sequence
QKVTSLTACLVDQSLRLDCRHENTSSSPIQYEFSLTRETKKHVLFGTVGV PEHTYRSRTNFTSKYNMKVLYLSAFTSKDEGTYTCALHHSGHSPPISSQN VTVLRDKLVKC -
Predicted molecular weight
13 kDa -
Amino acids
20 to 130 -
Additional sequence information
Fused to Fc portion of human IgG1. SDS page: band of ~ 50kDa. Thy-1 (~13kDa) + Fc fusion (~29.3kDa) = ~42kDa. Higher due to post-translational modifications given that Thy-1 is a glycoprotein.
-
Specifications
Our Abpromise guarantee covers the use of ab157072 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
SDS-PAGE
-
Form
Lyophilized -
Additional notes
Binds to Human avß3 integrin. -
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Store at -20°C.
Constituent: 99% PBS
-
ReconstitutionReconstitute with 50µl sterile distilled water. Further dilutions should be made with medium containing 5% fetal calf serum or a carrier protein. After reconstitution, prepare aliquots and store at -20°C. Avoid freeze/thaw cycles.
General Info
-
Alternative names
- CD7
- CD90
- CD90 antigen
see all -
Function
May play a role in cell-cell or cell-ligand interactions during synaptogenesis and other events in the brain. -
Sequence similarities
Contains 1 Ig-like V-type (immunoglobulin-like) domain. -
Cellular localization
Cell membrane. - Information by UniProt
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
-
Datasheet download
References (2)
ab157072 has been referenced in 2 publications.
- Stern LA et al. Cellular-Based Selections Aid Yeast-Display Discovery of Genuine Cell-Binding Ligands: Targeting Oncology Vascular Biomarker CD276. ACS Comb Sci 21:207-222 (2019). PubMed: 30620189
- Yousefi-Rad N et al. Antigenic assessment of a recombinant human CD90 protein expressed in prokaryotic expression system. Protein Expr Purif 116:139-43 (2015). PubMed: 26297626