Overview

  • Product name

    Recombinant Human CD97 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MGGRVFLAFCVWLTLPGAETQDSRGCARWCPQNSSCVNATACRCNPGFSS FSEIITTPTETCDDINECATPSKVSCGKFSDCWNTEGSYDCVCSPGYEPV SGAKTFKNESENTCQDVDECSSGRHQCDSSTVCFNTVGSYSCRCRPGWKP RHGIPNNQKDTVCEDMTFSTWTPPPGVHSQTLSRFFDKVQDLGRDSKTSS AEVTIQNVIKLVDELMEAPGDVEALAPPVRHLIATQLLSNLEDIMRILAK SLPKGPFTYISPSNTELTLMIQERGDKNVTMGQSSARMKLNWAVAAGAED PGPAVAGILSIQNMTTLLANASLNLHSKKQAELEEIYESSIRGVQLRRLS AVNSIFLSHNNTKELNSPILFAFSHLESSDGEAGRDPPAKDVMPGPRQEL LCAFWKSDSDRGGHWATEGCQVLGSKNGSTTCQCSHLSSFAILMAHYDVE DWKLTLITRVGLALSLFCLLLCILTFLLVRPIQGSRTTIHLHLCICLFVG STIFLAGIENEGGQVGLRCRLVAGLLHYCFLAAFCWMSLEGLELYFLVVR VFQGQGLSTRWLCLIGYGVPLLIVGVSAAIYSKGYGRPRYCWLDFEQGFL WSFLGPVTFIILCNAVIFVTTVWKLTQKFSEINPDMKKLKKARALTITAI AQLFLLGCTWVFGLFIFDDRSLVLTYVFTILNCLQGAFLYLLHCLLNKKV REEYRKWACLVAGGSKYSEFTSTTSGTGHNQTRALRASESGI
    • Molecular weight

      107 kDa including tags
    • Amino acids

      1 to 742

Specifications

Our Abpromise guarantee covers the use of ab131865 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

    SDS-PAGE

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • ADGRE5
    • Adhesion G protein-coupled receptor E5
    • CD 97
    • CD_antigen=CD97
    • CD97
    • CD97 antigen
    • CD97 antigen subunit beta
    • CD97 molecule
    • CD97_HUMAN
    • Leukocyte antigen CD97
    • Seven span transmembrane protein
    • Seven transmembrane helix receptor
    • Seven transmembrane heterodimeric receptor associated with inflammation
    • TM7LN 1
    • TM7LN1
    see all
  • Function

    Receptor potentially involved in both adhesion and signaling processes early after leukocyte activation. Plays an essential role in leukocyte migration.
  • Tissue specificity

    Broadly expressed, found on most hematopoietic cells, including activated lymphocytes, monocytes, macrophages, dendritic cells, and granulocytes. Expressed also abundantly by smooth muscle cells. Expressed in thyroid, colorectal, gastric, esophageal and pancreatic carcinomas too. Expression are increased under inflammatory conditions in the CNS of multiple sclerosis and in synovial tissue of patients with rheumatoid arthritis. Increased expression of CD97 in the synovium is accompagnied by detectable levels of soluble CD97 in the synovial fluid.
  • Sequence similarities

    Belongs to the G-protein coupled receptor 2 family. LN-TM7 subfamily.
    Contains 5 EGF-like domains.
    Contains 1 GPS domain.
  • Domain

    The first two EGF domains mediate the interaction with DAF. A third tandemly arranged EGF domain is necessary for the structural integrity of the binding region.
    Binding to chondroitin sulfate is mediated by the fourth EGF domain.
  • Post-translational
    modifications

    Proteolytically cleaved into 2 subunits, an extracellular alpha subunit and a seven-transmembrane subunit.
  • Cellular localization

    Cell membrane and Secreted > extracellular space.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab131865 stained with Coomassie Blue.

References

ab131865 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab131865.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up