Overview

Description

  • Nature
    Recombinant
  • Source
    HEK 293 cells
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      DGGFDLSDALPDNENKKPTAIPKKPSAGDDFDLGDAVVDGENDDPRPPNP PKPMPNPNPNHPSSSGSFSDADLADGVSGGEGKGGSDGGGSHRKEGEEAD
    • Molecular weight
      36 kDa
    • Amino acids
      23 to 122
    • Additional sequence information
      The extracellular domain of CD99 was fused with Fc fragment of Human IgG1 at the C-terminus. (AAH02584)

Associated products

Specifications

Our Abpromise guarantee covers the use of ab174036 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Endotoxin level
    < 1.000 Eu/µg
  • Purity
    > 92 % SDS-PAGE.

  • Form
    Lyophilised
  • Additional notes

    After reconstitution store under sterile conditions for 1 month at 4°C - 8°C or 3 months at -20°C to -80°C. Avoid repeated freeze-thaw cycles.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at 4°C prior to reconstitution. Store at -20°C or -80°C. Please see notes section.

    Information available upon request.

  • Reconstitution
    It is recommended to reconstitute the lyophilized protein in 100 µl sterile deionized water to a final concentration of 1 mg/ml. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long term storage.

General Info

  • Alternative names
    • 12E7
    • Antigen identified by monoclonal 12E7, Y homolog
    • Antigen identified by monoclonal antibodies 12E7, F21 and O13
    • CD99
    • CD99 antigen
    • CD99 molecule
    • CD99_HUMAN
    • Cell surface antigen 12E7
    • Cell surface antigen HBA 71
    • Cell surface antigen O13
    • E2 antigen
    • HBA71
    • MIC 2X
    • MIC 2Y
    • MIC2
    • MIC2 (monoclonal antibody 12E7)
    • MIC2X
    • MIC2Y
    • MSK5X
    • Protein MIC2
    • Surface antigen MIC2
    • T cell surface glycoprotein E2
    • T-cell surface glycoprotein E2
    see all
  • Function
    Involved in T-cell adhesion processes. It is involved in spontaneous rosette formation with erythrocytes.
  • Sequence similarities
    Belongs to the CD99 family.
  • Post-translational
    modifications
    Extensively O-glycosylated.
  • Cellular localization
    Membrane.
  • Information by UniProt

Images

  • SDS-PAGE analysis of reduced ab174036 and staining overnight with Coomassie Blue. DTT-reduced Protein migrates as 45-50 kDa due to glycosylation.

References

ab174036 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab174036.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up