Recombinant Human CD99 protein (Fc Chimera His Tag) (ab222999)

Description

  • Product name

    Recombinant Human CD99 protein (Fc Chimera His Tag)
    See all CD99 proteins and peptides
  • Purity

    > 95 % SDS-PAGE.
    Purified using conventional chromatography techniques.
  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    Baculovirus infected insect cells
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      ADPDGGFDLSDALPDNENKKPTAIPKKPSAGDDFDLGDAVVDGENDDPRP PNPPKPMPNPNPNHPSSSGSFSDADLADGVSGGEGKGGSDGGGSHRKEGE EADLEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTC VVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQ DWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKN QVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLT VDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKHHHHHH
    • Predicted molecular weight

      37 kDa including tags
    • Amino acids

      23 to 122
    • Tags

      His tag C-Terminus
    • Additional sequence information

      Extracellular domain fused to hlgG-His-tag at C-terminus.

Specifications

Our Abpromise guarantee covers the use of ab222999 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituents: 10% Glycerol, PBS

General Info

  • Alternative names

    • 12E7
    • Antigen identified by monoclonal 12E7, Y homolog
    • Antigen identified by monoclonal antibodies 12E7, F21 and O13
    • CD99
    • CD99 antigen
    • CD99 molecule
    • CD99_HUMAN
    • Cell surface antigen 12E7
    • Cell surface antigen HBA 71
    • Cell surface antigen O13
    • E2 antigen
    • HBA71
    • MIC 2X
    • MIC 2Y
    • MIC2
    • MIC2 (monoclonal antibody 12E7)
    • MIC2X
    • MIC2Y
    • MSK5X
    • Protein MIC2
    • Surface antigen MIC2
    • T cell surface glycoprotein E2
    • T-cell surface glycoprotein E2
    see all
  • Function

    Involved in T-cell adhesion processes. It is involved in spontaneous rosette formation with erythrocytes.
  • Sequence similarities

    Belongs to the CD99 family.
  • Post-translational
    modifications

    Extensively O-glycosylated.
  • Cellular localization

    Membrane.
  • Information by UniProt

Images

  • 3 μg ab222999 was analysed by 15% SDS-PAGE.

References

ab222999 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab222999.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up