Description

  • Product name

    Recombinant Human CD99 protein (His tag)
    See all CD99 proteins and peptides
  • Purity

    > 95 % SDS-PAGE.

  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    HEK 293 cells
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      DGGFDLSDALPDNENKKPTAIPKKPSAGDDFDLGDAVVDGENDDPRPPNP PKPMPNPNPNHPSSSGSFSDADLADGVSGGEGKGGSDGGGSHRKEGEEAD
    • Predicted molecular weight

      11 kDa including tags
    • Amino acids

      23 to 122
    • Tags

      His tag N-Terminus
    • Additional sequence information

      Extracellular domain (AAH02584).

Specifications

Our Abpromise guarantee covers the use of ab220556 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at 4°C (stable for up to 12 months). Store at -80°C. Avoid freeze / thaw cycle. Working aliquots stored with a carrier protein are stable for at least 3 months at -20°C to -80°C..

    pH: 7.40
    Constituents: 95% PBS, 5% Trehalose

    Lyophilized from 0.22 µm filtered solution.

  • Reconstitution
    It is recommended to reconstitute the lyophilized protein in sterile deionized water to a final concentration of 1mg/ml. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long term storage.

General Info

  • Alternative names

    • 12E7
    • Antigen identified by monoclonal 12E7, Y homolog
    • Antigen identified by monoclonal antibodies 12E7, F21 and O13
    • CD99
    • CD99 antigen
    • CD99 molecule
    • CD99_HUMAN
    • Cell surface antigen 12E7
    • Cell surface antigen HBA 71
    • Cell surface antigen O13
    • E2 antigen
    • HBA71
    • MIC 2X
    • MIC 2Y
    • MIC2
    • MIC2 (monoclonal antibody 12E7)
    • MIC2X
    • MIC2Y
    • MSK5X
    • Protein MIC2
    • Surface antigen MIC2
    • T cell surface glycoprotein E2
    • T-cell surface glycoprotein E2
    see all
  • Function

    Involved in T-cell adhesion processes. It is involved in spontaneous rosette formation with erythrocytes.
  • Sequence similarities

    Belongs to the CD99 family.
  • Post-translational
    modifications

    Extensively O-glycosylated.
  • Cellular localization

    Membrane.
  • Information by UniProt

Images

  • SDS-PAGE analysis of reduced ab220556 stained overnight with Coomassie Blue.

    The reducing protein migrates as 25 kDa in SDS-PAGE due to glycosylation.

References

ab220556 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab220556.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up