Description

  • Product name

    Recombinant Human CD99L2 protein
  • Expression system

    Wheat germ
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MVAWRSAFLVCLAFSLATLVQRGSGDFDDFNLEDAVKETSSVKPALGMYH KLDGLKQQNFILSLFWMLEVLYQGVGWATFSLKALGKNLSLTFPTSGGSR CSLVCGCITPISASVVTWCSPFCVSLLSLTKMLVSGFKAHLDNPG
    • Amino acids

      1 to 145
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab164423 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • C99L2_HUMAN
    • CD99
    • CD99 antigen-like protein 2
    • CD99L2
    • MIC2-like protein 1
    • MIC2L1
    see all
  • Function

    May function as a homophilic adhesion molecule. Functions in leukocyte-endothelial cell interactions during leukocyte extravasation, and in particular, at the diapedesis step. Does not seem to be involved in docking of leukocytes to the vessel wall or in lymphocyte diapedesis.
  • Tissue specificity

    Expressed in brain, heart, lung, liver, spleen, kidney, stomach, small intestine, skeletal muscle, ovary, thymus, testis and uterus. Lower expression seen in thymus. Expressed in E18 uterus and placenta.
  • Sequence similarities

    Belongs to the CD99 family.
  • Post-translational
    modifications

    O-glycosylated.
  • Cellular localization

    Cell membrane. Cell junction.
  • Information by UniProt

Images

  • ab164423 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab164423 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab164423.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up