Description

  • Product name

    Recombinant Human CDA protein
  • Biological activity

    Specific activity is > 10,000 pmol/min/ug, and is defined as the amount of required to deaminate 1.0 pmole of cytidine per min at pH 7.5 at 25C.

  • Purity

    > 90 % SDS-PAGE.
    ab99441 is purified using conventional chromatography techniques.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMAQKRPACTLKPECVQQLLVCSQEAKQSAY CPYSHFPVGAALLTQEGRIFKGCNIENACYPLGICAERTAIQKAVSEGYK DFRAIAIASDMQDDFISPCGACRQVMREFGTNWPVYMTKPDGTYIVMTVQ ELLPSSFGPEDLQKTQ
    • Predicted molecular weight

      18 kDa including tags
    • Amino acids

      1 to 146
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab99441 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry

    MALDI-TOF
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.0154% DTT, 0.316% Tris HCl, 0.0584% EDTA, 40% Glycerol, 0.58% Sodium chloride

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names

    • CDD
    • Cytidine aminohydrolase
    • Cytidine deaminase
    • EC 3.5.4.5
  • Relevance

    CDA (Cytidine deaminase) scavengers exogenous and endogenous cytidine and 2'-deoxycytidine for UMP synthesis. Growth inhibition of granulocyte-macrophage colony foring cells by human cytidine deaminase requires the catalytic function of the protein. It is highly expressed in granulocytes.

Images

  • 15% SDS-PAGE showing ab99441 at approximately 18.3kDa (3µg).

References

ab99441 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Question
Answer

Thank you for contacting Abcam regarding the ab99441.

I have had the opportunity to speak with the lab regarding your question. I have been told thatit may be active, but regrettably, it hasn’t been tested yet. Although it is scheduled to be tested eventually, we can’t give you a specific date on when we will have the results.

I hope this information is helpful. Please contact me if you have any questions.

Read More

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up