Recombinant Human CDADC1 protein (ab164345)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      KCPCDECVPLIKGAGIKQIYAGDVDVGKKKADISYMRFGELEGVSKFTWQ LNPSGAYGLEQNEPERRENGVLRPVPQKEEQHQDKKLRLGIH
    • Amino acids
      423 to 514
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab164345 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • bA103J18.1
    • CDAC1_HUMAN
    • CDADC1
    • cytidine and dCMP deaminase domain containing 1
    • Cytidine and dCMP deaminase domain-containing protein 1
    • MGC150615
    • MGC41774
    • MGC57136
    • NYD-SP15
    • OTTHUMP00000018405
    • protein kinase NYD-SP15
    • RP11-103J18.2
    • Testis development protein NYD-SP15
    see all
  • Function
    May play an important role in testicular development and spermatogenesis.
  • Tissue specificity
    Widely expressed. Expressed at high levels in the testis.
  • Sequence similarities
    Belongs to the cytidine and deoxycytidylate deaminase family.
  • Information by UniProt

Images

  • ab164345 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab164345 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab164345.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up