Recombinant Human Cdc14B protein (ab160091)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MKRKSERRSSWAAAPPCSRRCSSTSPGVKKIRSSTQQDPRRRDPQDDVYL DITDRLCFAILYSRPKSASNVHYFSIDNELEYENFYADFGPLNLAMVYRY CCKINKKLKSITMLRKKIVHFTGSDQRKQANAAFLVGCYMVIYLGRTPEE AYRILIFGETSYIPFRDAAYGSCNFYITLLDCFHAVKKAMQYGFLNFNSF NLDEYEHYEKAENGDLNWIIPDRFIAFCGPHSRARLESGYHQHSPETYIQ YFKNHNVTTIIRLNKRMYDAKRFTDAGFDHHDLFFADGSTPTDAIVKEFL DICENAEGAIAVHCKAGLGRTGTLIACYIMKHYRMTAAETIAWVRICRPG SVIGPQQQFLVMKQTNLWLEGDYFRQKLKGQENGQHRAAFSKLLSGVDDI SINGVENQDQQEPEPYSDDDEINGVTQGDRLRALKSRRQSKTNAIPLTDG WLSQAVTFLDRLLIWLGIHKD
    • Amino acids
      1 to 471
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160091 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CC14B_HUMAN
    • Cdc 14B
    • Cdc 14B1
    • Cdc 14B2
    • CDC 14B3
    • CDC14 cell division cycle 14 homolog B
    • CDC14 homolog B
    • Cdc14b
    • Cdc14B1
    • Cdc14B2
    • CDC14B3
    • Cell division cycle 14 homolog B
    • Dual specificity protein phosphatase CDC14B
    • hCDC 14B
    • hCDC14B
    • OTTHUMP00000063774
    see all
  • Function
    Dual-specificity phosphatase involved in DNA damage response. Essential regulator of the G2 DNA damage checkpoint: following DNA damage, translocates to the nucleus and dephosphorylates FZR1/CDH1, a key activator of the anaphase promoting complex/cyclosome (APC/C). Dephosphorylation of FZR1/CDH1 activates the APC/C, leading to the ubiquitination of PLK1, preventing entry into mitosis. Preferentially dephosphorylates proteins modified by proline-directed kinases.
  • Sequence similarities
    Belongs to the protein-tyrosine phosphatase family. Non-receptor class CDC14 subfamily.
  • Domain
    Composed of two structurally equivalent A and B domains that adopt a dual specificity protein phosphatase (DSP) fold.
  • Cellular localization
    Nucleus > nucleolus. Nucleus > nucleoplasm. Following DNA damage, translocates from the nucleolus to the nucleoplasm and interacts with FZR1/CDH1.
  • Information by UniProt

Images

  • ab160091 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160091 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160091.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up