Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      FRSNQRKMLNLLLERDTSFTVCPDVPRTPVGKFLGDSANLSILSGGTPKC CLDLSNLSSGEITATQLTTSADLDETGHLDSSGLQEVHLAGMNHDQHLMK CSPAQLLCST
    • Amino acids
      21 to 130
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158077 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CDC 25
    • Cdc 25C
    • CDC25
    • CDC25C
    • Cell division cycle 25 homolog C
    • Cell division cycle 25C
    • Cell division cycle 25C protein
    • Dual specificity phosphatase Cdc25C
    • M phase inducer phosphatase 3
    • M-phase inducer phosphatase 3
    • Mitosis inducer CDC25
    • MPIP3
    • MPIP3_HUMAN
    • Phosphotyrosine phosphatase
    • PPP1R60
    • protein phosphatase 1, regulatory subunit 60
    see all
  • Function
    Functions as a dosage-dependent inducer in mitotic control. It is a tyrosine protein phosphatase required for progression of the cell cycle. It directly dephosphorylates CDK1 and activate its kinase activity.
  • Sequence similarities
    Belongs to the MPI phosphatase family.
    Contains 1 rhodanese domain.
  • Developmental stage
    Expressed predominantly in G2 phase.
  • Post-translational
    modifications
    Phosphorylated by CHK1 on Ser-216. This phosphorylation creates a binding site for 14-3-3 protein and inhibits the phosphatase. Phosphorylated by PLK4.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • ab158077 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158077 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158077.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up