Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      KGDKNQQQQQNQHQQPTAPPQQAAAPPQAPPPQQNSTQTNGTAGGAGAGV GGTGAGLQHSQDSSLNQVPPNKKPRLGPSGANSGGPVMPSDYQHSSSRLN Y
    • Amino acids
      367 to 467
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161532 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • bA346C16.3
    • CDC2 related protein kinase 6
    • CDC2-related protein kinase 6
    • CDC2L6
    • CDK11
    • Cdk19
    • CDK19_HUMAN
    • CDK8 like cyclin dependent kinase
    • Cell division cycle 2 like 6 (CDK8 like)
    • Cell division cycle 2 like protein kinase 6
    • Cell division cycle 2-like protein kinase 6
    • Cell division protein kinase 19
    • Cyclin dependent kinase (CDC2 like) 11
    • Cyclin dependent kinase 11
    • Cyclin dependent kinase 19 variant 2
    • Cyclin-dependent kinase 11
    • Cyclin-dependent kinase 19
    • Death preventing kinase
    • Death-preventing kinase
    • KIAA1028
    see all
  • Sequence similarities
    Belongs to the protein kinase superfamily. CMGC Ser/Thr protein kinase family. CDC2/CDKX subfamily.
    Contains 1 protein kinase domain.
  • Information by UniProt

Images

  • ab161532 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161532 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161532.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up