Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      SKMISNPTNFNHVAHMGPGDGMQVLMDLPLSAVPPSQEERPGPAPTNLAR QPPSRNKPYISWPSSGGSEPSVTVPLRSMSDPDQDFDKEPDSDSTKHSTP
    • Amino acids
      1580 to 1679
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160556 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CDC42 binding protein kinase beta
    • CDC42-binding protein kinase beta
    • CDC42BPB
    • DMPK like beta
    • DMPK-like beta
    • KIAA1124
    • MRCK beta
    • MRCKB_HUMAN
    • Myotonic dystrophy kinase related CDC42 binding kinase beta
    • Myotonic dystrophy kinase-related CDC42-binding kinase beta
    • Myotonic dystrophy protein kinase like beta
    • Myotonic dystrophy protein kinase-like beta
    • Serine/threonine protein kinase MRCK beta
    • Serine/threonine-protein kinase MRCK beta
    see all
  • Function
    May act as a downstream effector of CDC42 in cytoskeletal reorganization. Contributes to the actomyosin contractility required for cell invasion, through the regulation of MYPT1 and thus MLC2 phosphorylation.
  • Tissue specificity
    Expressed in all tissues examined, with high levels in heart, brain, placenta and lung.
  • Sequence similarities
    Belongs to the protein kinase superfamily. AGC Ser/Thr protein kinase family. DMPK subfamily.
    Contains 1 AGC-kinase C-terminal domain.
    Contains 1 CNH domain.
    Contains 1 CRIB domain.
    Contains 1 PH domain.
    Contains 1 phorbol-ester/DAG-type zinc finger.
    Contains 1 protein kinase domain.
  • Cellular localization
    Cytoplasm. Displays a dispersed punctate distribution and concentrates along the cell periphery, especially at the leading edge and cell-cell junction. This concentration is PH-domain dependent.
  • Information by UniProt

Images

  • ab160556 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160556 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160556.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up