Description

  • Product name

    Recombinant Human CDC42 protein
    See all CDC42 proteins and peptides
  • Expression system

    Escherichia coli
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEP YTLGLFDTAGQEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPE ITHHCPKTPFLLVGTQIDLRDDPSTIEKLAKNKQKPITPETAEKLARDLK AVKYVECSALTQKGLKNVFDEAILAALEPPEPKKSRRC
    • Predicted molecular weight

      48 kDa
    • Amino acids

      1 to 188
    • Tags

      His tag N-Terminus , GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab43599 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Functional Studies

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 7.50
    Constituents: 0.0038% EGTA, 0.00174% PMSF, 0.00385% DTT, 0.79% Tris HCl, 0.00292% EDTA, 25% Glycerol, 0.87% Sodium chloride

General Info

  • Alternative names

    • CDC42
    • CDC42_HUMAN
    • CDC42Hs
    • Cell division control protein 42 homolog
    • Cell division cycle 42
    • Cell division cycle 42 (GTP binding protein 25kDa)
    • dJ224A6.1.1 (cell division cycle 42 (GTP-binding protein, 25kD))
    • dJ224A6.1.2 (cell division cycle 42 (GTP-binding protein, 25kD))
    • G25K
    • G25K GTP-binding protein
    • Growth regulating protein
    • GTP binding protein 25kDa
    • Small GTP binding protein CDC42
    • TKS
    see all
  • Function

    Plasma membrane-associated small GTPase which cycles between an active GTP-bound and an inactive GDP-bound state. In active state binds to a variety of effector proteins to regulate cellular responses. Involved in epithelial cell polarization processes. Causes the formation of thin, actin-rich surface projections called filopodia.
  • Sequence similarities

    Belongs to the small GTPase superfamily. Rho family. CDC42 subfamily.
  • Post-translational
    modifications

    AMPylation at Tyr-32 and Thr-35 are mediated by bacterial enzymes in case of infection by H.somnus and V.parahaemolyticus, respectively. AMPylation occurs in the effector region and leads to inactivation of the GTPase activity by preventing the interaction with downstream effectors, thereby inhibiting actin assembly in infected cells. It is unclear whether some human enzyme mediates AMPylation; FICD has such ability in vitro but additional experiments remain to be done to confirm results in vivo.
  • Cellular localization

    Cell membrane.
  • Information by UniProt

Images

  • Recombinant Human CDC42 protein (ab43599)
    Observed band size: 48 kDa
    why is the actual band size different from the predicted?



    The GST+His tag at the N-terminus gives almost ~27kDa increase in molecular weight of the CDC42 protein.

References

ab43599 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab43599.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up