Overview

  • Product name
    Recombinant Human CDC42BPG protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      RREMLKDPFVRSKLISPPTNFNHLVHVGPANGRPGARDKSPAPEEKGRVA RGSGPQRPHSFSEALRRPASMGSEGLGGDADPMKRKPWTSLSSESVSCPQ GSLSPA
    • Amino acids
      1423 to 1528
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163124 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CDC42 binding protein kinase gamma
    • DMPK like gamma
    • DMPK2
    • MRCK gamma
    • Myotonic dystrophy kinase related CDC42 binding kinase gamma
    • Myotonic dystrophy protein kinase like alpha
    • Serine/threonine protein kinase MRCK gamma
    see all
  • Relevance
    May act as a downstream effector of CDC42 in cytoskeletal reorganization. Contributes to the actomyosin contractility required for cell invasion, through the regulation of MYPT1 and thus MLC2 phosphorylation.
  • Cellular localization
    Cytoplasm. Note: concentrates at the leading edge of cells.

Images

  • ab163124 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163124 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163124.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up