Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      PLLKNAISLPVIGGPQALTLPTAQAPPKPPRLHLETPQPSPQEGGSVDIW RIPETGSPNSGLTPESGAEEPFLSNASSLLSLHVDLGPSILDDVLQIMDQ DLDSMQIPT
    • Amino acids
      102 to 210
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160993 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Binder of Rho GTPases 1
    • BORG1
    • BORG1_HUMAN
    • CDC42 effector protein (Rho GTPase binding) 2
    • Cdc42 effector protein 2
    • Cdc42ep2
    • CEP2
    • CRIB-containing BOGR1 protein
    see all
  • Function
    Probably involved in the organization of the actin cytoskeleton. May act downstream of CDC42 to induce actin filament assembly leading to cell shape changes. Induces pseudopodia formation in fibroblasts in a CDC42-dependent manner.
  • Tissue specificity
    Highly expressed in the heart. Weakly expressed in the pancreas and liver.
  • Sequence similarities
    Belongs to the BORG/CEP family.
    Contains 1 CRIB domain.
  • Domain
    The CRIB domain mediates interaction with CDC42.
  • Cellular localization
    Endomembrane system. Cytoplasm > cytoskeleton.
  • Information by UniProt

Images

  • ab160993 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160993 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160993.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up