Description

  • Product name

    Recombinant Human CDC42EP3 protein
  • Expression system

    Wheat germ
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MPAKTPIYLKAANNKKGKKFKLRDILSPDMISPPLGDFRHTIHIGKEGQH DVFGDISFLQGNYELLPGNQEKAHLGQFPGHNEFFRANSTSDSVFTETPS PVLKNAISLPTIGGSQALMLPLLSPVTFNSKQESFGPAKLPRLSCEPVME EKAQEKSSLLENGTVHQGDTSWGSSGSASQSSQGRDSHSSSLSEQYPDWP AEDMFDHPTPCELIKGKTKSEESLSDLTGSLLSLQLDLGPSLLDEVLNVM DKNK
    • Amino acids

      1 to 254
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161060 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Binder of Rho GTPases 2
    • BORG2
    • CDC42 effector protein (Rho GTPase binding) 3
    • Cdc42 effector protein 3
    • CEP3
    • CRIB containing BORG2 protein
    • MSE55 related Cdc42 binding protein
    • MSE55 related protein
    • UB1
    see all
  • Relevance

    CDC42EP3 is probably involved in the organization of the actin cytoskeleton. May act downstream of CDC42 to induce actin filament assembly leading to cell shape changes. It induces pseudopodia formation in fibroblasts.
  • Cellular localization

    Endomembrane system; Peripheral membrane protein. Cytoplasm; cytoskeleton.

Images

  • ab161060 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

This product has been referenced in:

  • Calvo F  et al. Cdc42EP3/BORG2 and Septin Network Enables Mechano-transduction and the Emergence of Cancer-Associated Fibroblasts. Cell Rep 13:2699-714 (2015). Read more (PubMed: 26711338) »
See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161060.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up