Overview

  • Product name

    Recombinant Human CDC42EP4 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      MPILKQLVSSSVHSKRRSRADLTAEMISAPLGDFRHTMHVGRAGDAFGDT SFLNSKAGEPDGESLDEQPSSSSSKRSLLSRKFRGSKRSQSVTRGEREQR DMLGSLRDSALFVKNAMSLPQLNEKEAAEKGTSKLPKSLSSSPVKKANDG EGGDEEAGTEEAVPRRNGAAGPHSPDPLLDEQAFGDLTDLPVVPKATYGL KHAESIMSFHIDLGPSMLGDVLSIMDKEEWDPEEGEGGYHGDEGAAGTIT QAPPYAVAAPPLARQEGKAGPDLPSLPSHALEDEGWAAAAPSPGSARSMG SHTTRDSSSLSSCTSGILEERSPAFRGPDRARAAVSRQPDKEFSFMDEEE EDEIRV
    • Amino acids

      1 to 356
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161697 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Binder of Rho GTPases 4
    • BORG4
    • BORG4_HUMAN
    • CDC42 effector protein (Rho GTPase binding) 4
    • Cdc42 effector protein 4
    • CDC42EP4
    • CEP4
    see all
  • Function

    Probably involved in the organization of the actin cytoskeleton. May act downstream of CDC42 to induce actin filament assembly leading to cell shape changes. Induces pseudopodia formation, when overexpressed in fibroblasts.
  • Tissue specificity

    Not detected in any of the adult tissues tested. May be expressed only in fetal or embryonic tissues.
  • Sequence similarities

    Belongs to the BORG/CEP family.
    Contains 1 CRIB domain.
  • Cellular localization

    Endomembrane system. Cytoplasm > cytoskeleton.
  • Information by UniProt

Images

  • ab161697 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161697 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161697.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up