Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      FVCSTKNRRCKLLPLVMAAPLSMEHGTVTVVGIPPETDSSDRKNFFGRAF EKAAESTSSRMLHNHFDLSVIELKAEDRSKFLDALISLLS
    • Amino acids
      477 to 566
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159991 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CDC 45
    • CDC 45L
    • CDC45
    • CDC45 (cell division cycle 45, S.cerevisiae homolog) like
    • CDC45 cell division cycle 45 like
    • CDC45 like
    • CDC45 related protein
    • CDC45_HUMAN
    • CDC45L2
    • Cell division control protein 45 homolog
    • Cell division cycle 45 like
    • Cell division cycle 45 like 2
    • PORC PI 1
    • PORC-PI-1
    see all
  • Function
    Required for initiation of chromosomal DNA replication.
  • Tissue specificity
    Widely expressed, highest levels are found in adult testis and thymus and in fetal liver.
  • Sequence similarities
    Belongs to the CDC45 family.
  • Developmental stage
    Transcript peaks at G1-S transition, but total protein remains constant throughout the cell cycle. Expressed in multiple tissues during embryogenesis, including neural crest-derived structures.
  • Cellular localization
    Cytoplasm. Nucleus.
  • Information by UniProt

Images

  • ab159991 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159991 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159991.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up