Overview

  • Product name

    Recombinant Human CDC5L protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MPRIMIKGGVWRNTEDEILKAAVMKYGKNQWSRIASLLHRKSAKQCKARW YEWLDPSIKKTEWSREEEEKLLHLAKLMPTQWRTIAPIIGRTAAQCLEHY EFLLDKAAQRDNEEETTDDPRKLKPGEIDPNPETKPARPDPIDMDEDELE MLSEARARLANTQGKKAKRKAREKQLEEARRLAALQKRRELRAAGIEIQK KRKRKRGVDYNAEIPFEKKPALGFYDTSEENYQALDADFRKLRQQDLDGE LRSEKEGRDRKKDKQHLKRKKESDLPSAILQTSGVSEFTKKRSKLVLPAP QISDAELQEVVKVGQASEIARQTAEESGITNSASSTLLSEYNVTNNSVAL RTPRTPASQDRILQEAQNLMALTNVDTPLKGGLNTPLHESDFSGVTPQRQ VVQTPNTVLSTPFRTPSNGAEGLTPRSGTTPKPVINSTPGRTPLRDKLNI NPEDGMADYSDPSYVKQMERESREHLRLGLLGLPAPKNDFEIVLPENAEK ELEEREIDDTYIEDAADVDARKQAIRDAERVKEMKRMHKAVQKDLPRPSE VNETILRPLNVEPPLTDLQKSEELIKKEMITMLHYDLLHHPYEPSGNKKG KTVGFGTNNSEHITYLEHNPYEKFSKEELKKAQDVLVQEMEVVKQGMSHG ELSSEAYNQVWEECYSQVLYLPGQSRYTRANLASKKDRIESLEKRLEINR GHMTTEAKRAAKMEKKMKILLGGYQSRAMGLMKQLNDLWDQIEQAHLELR TFEELKKHEDSAIPRRLECLKEDVQRQQEREKELQHRYADLLLEKETLKS KF
    • Molecular weight

      119 kDa including tags
    • Amino acids

      1 to 802

Specifications

Our Abpromise guarantee covers the use of ab132350 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • CDC5
    • CDC5 cell division cycle 5-like (S. pombe)
    • Cdc5 related protein
    • CDC5-LIKE
    • Cdc5-like protein
    • Cdc5l
    • CDC5L_HUMAN
    • CEF1
    • Cell division cycle 5 S. pombe homolog of
    • Cell division cycle 5-like protein
    • dJ319D22.1
    • KIAA0432
    • PCDC5RP
    • Pombe Cdc5 related protein
    • Pombe Cdc5-related protein
    see all
  • Function

    DNA-binding protein involved in cell cycle control. May act as a transcription activator. Component of the PRP19-CDC5L complex that forms an integral part of the spliceosome and is required for activating pre-mRNA splicing.
  • Tissue specificity

    Ubiquitously expressed in both fetal and adult tissues.
  • Involvement in disease

    A chromosomal aberration involving CDC5L is found in multicystic renal dysplasia. Translocation t(6;19)(p21;q13.1) with USF2.
  • Sequence similarities

    Belongs to the CEF1 family.
    Contains 2 HTH myb-type DNA-binding domains.
  • Post-translational
    modifications

    Phosphorylated on serine and threonine residues. Phosphorylation on Thr-411 and Thr-438 is required for CDC5L-mediated mRNA splicing. Has no effect on subcellular location nor on homodimerization. Phosphorylated in vitro by CDK2. Phosphorylation enhances interaction with PPP1R8.
  • Cellular localization

    Nucleus. Nucleus speckle. Cytoplasm. May shuttle between cytoplasm and nucleus.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab132350 stained with Coomassie Blue.

References

ab132350 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132350.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up