Overview

  • Product name

    Recombinant Human CDCA3 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      MGSAKSVPVTPARPPPHNKHLARVADPRSPSAGILRTPIQVESSPQPGLP AGEQLEGLKHAQDSDPRSPTLGIARTPMKTSSGDPPSPLVKQLSEVFETE DSKSNLPPEPVLPPEAPLSSELDLPLGTQLSVEEQMPPWNQTEFPSKQVF SKEEARQPTETPVASQSSDKPSRDPETPRSSGSMRNRWKPNSSKVLGRSP LTILQDDNSPGTLTLRQGKRPSPLSENVSELKEGAILGTGRLLKTGGRAW EQGQDHDKENQHFPLVES
    • Amino acids

      1 to 268
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab164399 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • C8
    • CDCA 3
    • Cell division cycle associated 3
    • Cell division cycle associated protein 3
    • Gene rich cluster C8
    • Gene rich cluster protein C8
    • GRCC 8
    • GRCC8
    • MGC2577
    • TOME 1
    • TOME1
    • Trigger of mitotic entry 1
    • Trigger of mitotic entry protein 1
    see all
  • Relevance

    CDCA3 (Cell division cycle associated 3) is an F-box-like protein which is required for entry into mitosis. It is associated with SKP1 as part of a SCF (SKP1-cullin-F-box) protein ligase complex, and is required for the ubiquitination and degradation of the CDK1 inhibitory tyrosine kinase WEE1 at G2/M phase.
  • Cellular localization

    Cytoplasmic. Cytosol.

Images

  • ab164399 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab164399 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab164399.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up