Description

  • Product name

    Recombinant Human CDCA4/HEPP protein
  • Expression system

    Wheat germ
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MFARGLKRKCVGHEEDVEGALAGLKTVSSYSLQRQSLLDMSLVKLQLCHM LVEPNLCRSVLIANTVRQIQEEMTQDGTWRTVAPQAAERAPLDRLVSTEI LCRAAWGQEGAHPAPGLGDGHTQGPVSDLCPVTSAQAPRHLQSSAWEMDG PRENRGSFHKSLDQIFETLETKNPSCMEELFSDVDSPYYDLDTVLTGMMG GARPGPCEGLEGLAPATPGPSSSCKSDLGELDHVVEILVET
    • Amino acids

      1 to 241
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162941 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.

     This product was previously labelled as CDCA4

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • CDCA 4
    • Cdca4
    • CDCA4_HUMAN
    • Cell division cycle associated 4
    • Cell division cycle-associated protein 4
    • FLJ20764
    • FLJ52878
    • Hematopoietic progenitor protein
    • Hepp
    • MGC19517
    • SEI 3
    • SEI-3/HEPP
    • SEI3
    see all
  • Function

    May participate in the regulation of cell proliferation through the E2F/RB pathway. May be involved in molecular regulation of hematopoietic stem cells and progenitor cell lineage commitment and differentiation.
  • Tissue specificity

    Highest levels of expression in the pancreas, thymus, testis, spleen, liver, placenta and leukocytes. Relatively low levels in the lung, kidney, prostate, ovary, small intestine and colon. Hardly detectable, if at all, in the brain, skeletal muscle and heart.
  • Sequence similarities

    Contains 1 SERTA domain.
  • Cellular localization

    Nucleus.
  • Information by UniProt

Images

  • ab162941 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162941 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162941.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up