Recombinant Human CDCA7L protein (ab163119)

Overview

  • Product name
    Recombinant Human CDCA7L protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MELATRYQIPKEVADIFNAPSDDEEFVGFRDDVPMETLSSEESCDSFDSL ESGKQQDVRFHSKYFTEELRRIFIEDTDSETEDFAGFTQSDLNGKTNPEV MVVESDLSDDGKASLVSEEEEDEEEDKATPRRSRSRRSSIGLRVAFQFPT KKLANKPDKNSSSEQLFSSARLQNEKKTILERKKDCRQVIQREDSTSESE DDSRDESQESSDALLKRTMNIKENKAMLAQLLAELNSMPDFFPVRTPTSA SRKKTVRRAFSEGQITRRMNPTRSARPPEKFALENFTVSAAKFAEEFYSF RRRKTIGGKCREYRRRHRISSFRPVEDITEEDLENVAITVRDKIYDKVLG NTCHQCRQKTIDTKTVCRNQGCCGVRGQFCGPCLRNRYGEDVRSALLDPD WVCPPCRGICNCSYCRKRDGRCATGILIHLAKFYGYDNVKEYLESLQKEL VEDN
    • Amino acids
      1 to 454
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163119 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • c Myc Interacting protein JPO2
    • CDCA7L
    • DKFZp762L0311
    • HR1
    • JPO2
    • Protein JPO2
    • R1
    • RAM2
    • Transcription Factor RAM2
    see all
  • Relevance
    CDCA7L is a member of the CDCA (cell division cycle associated) protein family. Members of this family have expression patterns associated with other known cell cycle genes such as cyclins and CDC genes. CDCA7L plays a role in transcriptional regulation as a repressor that inhibits monoamine oxidase A (MAOA) activity and gene expression by binding to the promoter. It also plays an important oncogenic role in mediating the full transforming effect of MYC in medulloblastoma cells. It is involved in apoptotic signaling pathways and may act downstream of P38-kinase and BCL-2, but upstream of CASP3/caspase-3 as well as CCND1/cyclin D1 and E2F1.
  • Cellular localization
    Cytoplasm. Nucleus. Note: associates with chromatin. Translocates from cytoplasm to nucleus under dexamethasone induction.

Images

  • ab163119 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163119 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163119.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up