Overview

  • Product name

    Recombinant Human CDCA7L/HR1 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      MELATRYQIPKEVADIFNAPSDDEEFVGFRDDVPMETLSSEESCDSFDSL ESGKQQDVRFHSKYFTEELRRIFIEDTDSETEDFAGFTQSDLNGKTNPEV MVVESDLSDDGKASLVSEEEEDEEEDKATPRRSRSRRSSIGLRVAFQFPT KKLANKPDKNSSSEQLFSSARLQNEKKTILERKKDCRQVIQREDSTSESE DDSRDESQESSDALLKRTMNIKENKAMLAQLLAELNSMPDFFPVRTPTSA SRKKTVRRAFSEGQITRRMNPTRSARPPEKFALENFTVSAAKFAEEFYSF RRRKTIGGKCREYRRRHRISSFRPVEDITEEDLENVAITVRDKIYDKVLG NTCHQCRQKTIDTKTVCRNQGCCGVRGQFCGPCLRNRYGEDVRSALLDPD WVCPPCRGICNCSYCRKRDGRCATGILIHLAKFYGYDNVKEYLESLQKEL VEDN
    • Amino acids

      1 to 454
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163119 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.

     This product was previously labelled as CDCA7L

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • c Myc Interacting protein JPO2
    • CDA7L_HUMAN
    • Cdca7l
    • Cell division cycle-associated 7-like protein
    • DKFZp762L0311
    • HR1
    • JPO2
    • Protein JPO2
    • R1
    • RAM2
    • Transcription factor RAM2
    see all
  • Function

    Plays a role in transcriptional regulation as a repressor that inhibits monoamine oxidase A (MAOA) activity and gene expression by binding to the promoter. Plays an important oncogenic role in mediating the full transforming effect of MYC in medulloblastoma cells. Involved in apoptotic signaling pathways; May act downstream of P38-kinase and BCL-2, but upstream of CASP3/caspase-3 as well as CCND1/cyclin D1 and E2F1.
  • Tissue specificity

    Ubiquitous. Overexpressed in medulloblastoma.
  • Cellular localization

    Cytoplasm. Nucleus. Associates with chromatin. Translocates from cytoplasm to nucleus under dexamethasone induction.
  • Information by UniProt

Images

  • ab163119 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163119 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163119.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up