Overview

  • Product name

    Recombinant Human CDCP1 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MAGLNCGVSIALLGVLLLGAARLPRGAEAFEIALPRESNITVLIKLGTPT LLAKPCYIVISKRHITMLSIKSGERIVFTFSCQSPENHFVIEIQKNIDCM SGPCPFGEVQLQPSTSLLPTLNRTFIWDVKAHKSIGLELQFSIPRLRQIG PGESCPDGVTHSISGRIDATVVRIGTFCSNGTVSRIKMQEGVKMALHLPW FHPRNVSGFSIANRSSIKRLCIIESVFEGEGSATLMSANYPEGFPEDELM TWQFVVPAHLRASVSFLNFNLSNCERKEERVEYYIPGSTTNPEVFKLEDK QPGNMAGNFNLSLQGCDQDAQSPGILRLQFQVLVQHPQNESSE
    • Molecular weight

      64 kDa including tags
    • Amino acids

      1 to 343

Specifications

Our Abpromise guarantee covers the use of ab131825 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 µg/µl.
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • 9030022E12Rik
    • AA409659
    • CD 318
    • CD_antigen=CD318
    • CD318
    • CD318 antigen
    • CDCP 1
    • Cdcp1
    • CDCP1_HUMAN
    • CUB domain containing protein 1
    • CUB domain-containing protein 1
    • E030027H19Rik
    • FLJ13772
    • FLJ22375
    • FLJ22969
    • Membrane glycoprotein gp140
    • MGC31813
    • OTTHUMP00000164120
    • OTTHUMP00000209568
    • RGD1305578
    • SIMA 135
    • SIMA135
    • Subtractive immunization M plus HEp3 associated 135 kDa protein
    • Subtractive immunization M plus HEp3-associated 135 kDa protein
    • Transmembrane and associated with src kinases
    • TRASK
    see all
  • Function

    May be involved in cell adhesion and cell matrix association. May play a role in the regulation of anchorage versus migration or proliferation versus differentiation via its phosphorylation. May be a novel marker for leukemia diagnosis and for immature hematopoietic stem cell subsets. Belongs to the tetraspanin web involved in tumor progression and metastasis.
  • Tissue specificity

    Highly expressed in mitotic cells with low expression during interphase. Detected at highest levels in skeletal muscle and colon with lower levels in kidney, small intestine, placenta and lung. Up-regulated in a number of human tumor cell lines, as well as in colorectal cancer, breast carcinoma and lung cancer. Also expressed in cells with phenotypes reminiscent of mesenchymal stem cells and neural stem cells.
  • Sequence similarities

    Contains 1 CUB domain.
  • Post-translational
    modifications

    Phosphorylated on tyrosine by kinases of the SRC family such as SRC and YES as well as by the protein kinase C gamma/PRKCG. Dephosphorylated by phosphotyrosine phosphatases. Also phosphorylated by suramin, a heparin analog. Tyrosine phosphorylated in response to dissociation of integrin alpha-6 beta-4 from laminin-5.
    N-glycosylated.
    A soluble form may also be produced by proteolytic cleavage at the cell surface (shedding). Another peptide of 80 kDa (p80) is present in cultured keratinocytes probably due to tryptic cleavage at an unidentified site on its N-terminal side. Converted to p80 by plasmin, a trypsin-like protease.
  • Cellular localization

    Secreted and Cell membrane. Shedding may also lead to a soluble peptide.
  • Information by UniProt

Images

  • ab131825 on 12.5% SDS-PAGE, stained with coomassie blue

References

ab131825 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab131825.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up