Recombinant Human CDH11 protein (ab192296)

Description

  • Product name

    Recombinant Human CDH11 protein
  • Purity

    > 95 % SDS-PAGE.
    Purity greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    HEK 293 cells
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      FAPERRGHLRPSFHGHHEKGKEGQVLQRSKRGWVWNQFFVIEEYTGPDPV LVGRLHSDIDSGDGNIKYILSGEGAGTIFVIDDKSGNIHATKTLDREERA QYTLMAQAVDRDTNRPLEPPSEFIVKVQDINDNPPEFLHETYHANVPERS NVGTSVIQVTASDADDPTYGNSAKLVYSILEGQPYFSVEAQTGIIRTALP NMDREAKEEYHVVIQAKDMGGHMGGLSGTTKVMITLTDVNDNPPKFPQSV YQMSVSEAAVPGEEVGRVKAKDPDIGENGLVTYNIVDGDGMESFEITTDY ETQEGVIKLKKPVDFETKRAYSLKVEAANVHIDPKFISNGPFKDTVTVKI AVEDADEPPMFLAPSYIHEVQENAAAGTVVGRVHAKDPDAANSPIRYSID RHTDLDRFFTINPEDGFIKTTKPLDREETAWLNITVFAAEIHNRHQEAKV PVAIRVLDVNDNAPKFAAPYEGFICESDQTKPLSNQPIVTISADDKDDTA NGPRFIFSLPPEIIHNPNFTVRDNRDNTAGVYARRGGFSRQKQDLYLLPI VISDGGIPPMSSTNTLTIKVCGCDVNGALLSCNAEAYILNAGLSTVDDIE GRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTC VVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQ DWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKN QVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLT VDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKHHHHHH
    • Predicted molecular weight

      94 kDa including tags
    • Amino acids

      23 to 617
    • Tags

      His tag C-Terminus
    • Additional sequence information

      Fused with a FC-6His tag at the C-terminus.

Specifications

Our Abpromise guarantee covers the use of ab192296 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    HPLC

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. The lyophilized protein is stable for a few weeks at room temperature. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituent: 100% PBS

    Lyophilized from a 0.2 µM filtered solution.

References

ab192296 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab192296.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up