Overview

  • Product name

    Recombinant Human CDH12 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MLTRNCLSLLLWVLFDGGLLTPLQPQPQQTLATEPRENVIHLPGQRSHFQ RVKRGWVWNQFFVLEEYVGSEPQYVGKLHSDLDKGEGTVKYTLSGDGAGT VFTIDETTGDIHAIRSLDREEKPFYTLRAQAVDIETRKPLEPESEFIIKV QDINDNEPKFLDGPYVATVPEMSPVGAYVLQVKATDADDPTYGNSARVVY SILQGQPYFSIDPKTGVIRTALPNMDREVKEQYQVLIQAKDMGGQLGGLA GTTIVNITLTDVNDNPPRFPKSIFHLKVPESSPIGSAIGRIRAVDPDFGQ NAEIEYNIVPGDGGNLFDIVTDEDTQEGVIKLKKPLDFETKKAYTFKVEA SNLHLDHRFHSAGPFKDTATVKISVLDVDEPPVFSKPLYTMEVYEDTPVG TIIGAVTAQDLDVGSSAVRYFIDWKSDGDSYFTIDGNEGTIATNELLDRE STAQYNFSIIASKVSNPLLTSKVNILINVLDVNEFPPEISVPYETAVCEN AKPGQIIQIVSAADRDLSPAGQQFSFRLSPEAAIKPNFTVRDFRNNTAGI ETRRNGYSRRQQELYFLPVVIEDSSYPVQSSTNTMTIRVCRCDSDGTILS CNVEAIFLPVGLSTGALIAILLCIVILLAIVVLYVALRRQKKKDTLMTSK EDIRDNVIHYDDEGGGEEDTQAFDIGALRNPKVIEENKIRRDIKPDSLCL PRQRPPMEDNTDIRDFIHQRLQENDVDPTAPPYDSLATYAYEGSGSVAES LSSIDSLTTEADQDYDYLTDWGPRFKVLADMFGEEESYNPDKVT
    • Molecular weight

      115 kDa including tags
    • Amino acids

      1 to 794

Associated products

Specifications

Our Abpromise guarantee covers the use of ab132546 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 µg/µl.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Br cadherin
    • BR-cadherin
    • Brain cadherin
    • CAD12_HUMAN
    • Cadherin 12
    • cadherin 12 (N cadherin 2)
    • Cadherin 12 precursor
    • Cadherin 12 type 2
    • Cadherin 12 type 2 (N cadherin 2)
    • Cadherin neural type 2
    • Cadherin-12
    • CDH12
    • CDHB
    • FLJ34857
    • N cadherin 2
    • N-cadherin 2
    • Neural type cadherin 2
    • Neuronal cadherin 2
    see all
  • Function

    Cadherins are calcium dependent cell adhesion proteins. They preferentially interact with themselves in a homophilic manner in connecting cells; cadherins may thus contribute to the sorting of heterogeneous cell types.
  • Tissue specificity

    Brain.
  • Sequence similarities

    Contains 5 cadherin domains.
  • Cellular localization

    Cell membrane.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE Stained with Coomassie Blue.

References

ab132546 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132546.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up