Overview

  • Product name

    Recombinant Human CDH18 protein
  • Protein length

    Protein fragment

Description

  • Nature

    Recombinant
  • Source

    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MASMTGGQQMGRGHHHHHHGNLYFQGGEFGWVWNQFFVLEEHMGPDPQYV GKLHSNSDKGDGSVKYILTGEGAGTIFIIDDTTGDIHSTKSLDREQKTHY VLHAQAIDRRTNKPLEPESEFIIKVQDINDNAPKFTDGPYIVTVPEMSDM GTSVLQVTATDADDPTYGNSARVVYSILQGQPYFSVDPKTGVIRTALHNM DREAREHYSVVIQAKDMAGQVGGLSGSTTVNITLTDVNDNPPRFPQKHYQ LYVPESAQVGSAVGKIKANDADTGSNADMTYSIINGDGMGIFSISTDKET REGILSLKKPLNYEKKKSYTLNIEGANTHLDFRFSHLGPFKDATMLKIIV GDVDEPPLFSMPSYLMEVYENAKIGTVVGTVLAQDPDSTNSLVRYFINYN VEDDRFFNIDANTGTIRTTKVLDREETPWYNITVTASEIDNPDLLSHVTV GIRVLDVNDNPPELAREYDIIVCENSKPGQVIHTISATDKDDFANGPRFN FFLDERLPVNPNFTLKDNEDNTASILTRRRRFSRTVQDVYYLPIMISDGG IPSLSSSSTLTIRVCACERDGRVRTCHAEAFLSS
    • Molecular weight

      65 kDa including tags
    • Amino acids

      54 to 608
    • Tags

      His tag N-Terminus , T7 tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab134888 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity

    > 90 % SDS-PAGE.
    ab134888 was expressed in E. coli as inclusion bodies, refolded using temperature shift inclusion body refolding technology, chromatographically purified and sterile-filtered.
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: Potassium chloride, 0.05% DTT, 0.32% Tris HCl, 0.02% EDTA, Glycerol, Sodium chloride, 3.4% DL-Arginine

General Info

  • Alternative names

    • CAD18_HUMAN
    • Cadherin 14
    • Cadherin 18
    • Cadherin 18, type 2
    • Cadherin-14
    • Cadherin-18
    • CDH14
    • CDH14L
    • CDH18
    • CDH24
    • EY CADHERIN
    see all
  • Function

    Cadherins are calcium dependent cell adhesion proteins. They preferentially interact with themselves in a homophilic manner in connecting cells; cadherins may thus contribute to the sorting of heterogeneous cell types.
  • Sequence similarities

    Contains 5 cadherin domains.
  • Cellular localization

    Cell membrane.
  • Information by UniProt

References

ab134888 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab134888.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up