Description

  • Product name

    Recombinant Human CDK1 protein
    See all CDK1 proteins and peptides
  • Expression system

    Baculovirus infected Sf9 cells
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MEDYTKIEKIGEGTYGVVYKGRHKTTGQVVAMKKIRLESEEEGVPSTAIR EISLLKELRH PNIVSLQDVLMQDSRLYLIFEFLSMDLKKYLDSIPPGQ YMDSSLVKSYLYQILQGIVFCH SRRVLHRDLKPQNLLIDDKGTIKLAD FGLARAFGIPIRVYTHEVVTLWYRSPEVLLGSAR YSTPVDIWSIGTIF AELATKKPLFHGDSEIDQLFRIFRALGTPNNEVWPEVESLQDYKNT FP KWKPGSLASHVKNLDENGLDLLSKMLIYDPAKRISGKMALNHPYFNDLDN QIKKM
    • Amino acids

      1 to 297
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab64306 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Additional notes

    This protein is inactive. CDK1 is activated by its counterpart Cyclin (eg. Cyclin A). Since CDK1 is not expressed with Cyclin, the protein is inactive
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 7.50
    Constituents: 0.00174% PMSF, 0.00385% DTT, 0.79% Tris HCl, 0.00292% EDTA, 25% Glycerol, 0.29% Sodium chloride

General Info

  • Alternative names

    • Cdc 2
    • Cdc2
    • CDC28A
    • CDK 1
    • CDK1
    • CDK1_HUMAN
    • CDKN1
    • CELL CYCLE CONTROLLER CDC2
    • Cell division control protein 2
    • Cell division control protein 2 homolog
    • Cell division cycle 2 G1 to S and G2 to M
    • Cell division protein kinase 1
    • Cell Divsion Cycle 2 Protein
    • Cyclin Dependent Kinase 1
    • Cyclin-dependent kinase 1
    • DKFZp686L20222
    • MGC111195
    • p34 Cdk1
    • p34 protein kinase
    • P34CDC2
    see all
  • Function

    Plays a key role in the control of the eukaryotic cell cycle. It is required in higher cells for entry into S-phase and mitosis. p34 is a component of the kinase complex that phosphorylates the repetitive C-terminus of RNA polymerase II.
  • Tissue specificity

    Isoform 2 is found in breast cancer tissues.
  • Sequence similarities

    Belongs to the protein kinase superfamily. CMGC Ser/Thr protein kinase family. CDC2/CDKX subfamily.
    Contains 1 protein kinase domain.
  • Cellular localization

    Nucleus.
  • Information by UniProt

Images

  • ab64306 on SDS-PAGE, MW 58kDa.

References

ab64306 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab64306.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up