Overview

Description

  • Nature

    Recombinant
  • Source

    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMEDYTKIEKIGEGTYGVVYKGRHKTTGQVV AMKKIRLESEEEGVPSTAIREISLLKELRHPNIVSLQDVLMQDSRLYLIF EFLSMDLKKYLDSIPPGQYMDSSLVKSYLYQILQGIVFCHSRRVLHRDLK PQNLLIDDKGTIKLADFGLARAFGIPIRVYTHEVVTLWYRSPEVLLGSAR YSTPVDIWSIGTIFAELATKKPLFHGDSEIDQLFRIFRALGTPNNEVWPE VESLQDYKNTFPKWKPGSLASHVKNLDENGLDLLSKMLIYDPAKRISGKM ALNHPYFNDLDNQIKKM
    • Molecular weight

      36 kDa including tags
    • Amino acids

      1 to 297
    • Tags

      His tag N-Terminus
    • Additional sequence information

      NCBI Accession No. NP_001777.

Specifications

Our Abpromise guarantee covers the use of ab202615 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity

    > 85 % SDS-PAGE.

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8
    Constituents: 10% Glycerol, 0.32% Tris HCl

General Info

  • Alternative names

    • Cdc 2
    • Cdc2
    • CDC28A
    • CDK 1
    • CDK1
    • CDK1_HUMAN
    • CDKN1
    • CELL CYCLE CONTROLLER CDC2
    • Cell division control protein 2
    • Cell division control protein 2 homolog
    • Cell division cycle 2 G1 to S and G2 to M
    • Cell division protein kinase 1
    • Cell Divsion Cycle 2 Protein
    • Cyclin Dependent Kinase 1
    • Cyclin-dependent kinase 1
    • DKFZp686L20222
    • MGC111195
    • p34 Cdk1
    • p34 protein kinase
    • P34CDC2
    see all
  • Function

    Plays a key role in the control of the eukaryotic cell cycle. It is required in higher cells for entry into S-phase and mitosis. p34 is a component of the kinase complex that phosphorylates the repetitive C-terminus of RNA polymerase II.
  • Tissue specificity

    Isoform 2 is found in breast cancer tissues.
  • Sequence similarities

    Belongs to the protein kinase superfamily. CMGC Ser/Thr protein kinase family. CDC2/CDKX subfamily.
    Contains 1 protein kinase domain.
  • Cellular localization

    Nucleus.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of ab202615 (3μg).

References

ab202615 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab202615.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up