Overview

  • Product name

    Recombinant Human CDK12 protein
  • Protein length

    Protein fragment

Description

  • Nature

    Recombinant
  • Source

    Baculovirus infected Sf9 cells
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      KEQRTRHLLTDLPLPPELPGGDLSPPDSPEPKAITPPQQPYKKRPKICCP RYGERRQTESDWGKRCVDKFDIIGIIGEGTYGQVYKAKDKDTGELVALKK VRLDNEKEGFPITAIREIKILRQLIHRSVVNMKEIVTDKQDALDFKKDKG AFYLVFEYMDHDLMGLLESGLVHFSEDHIKSFMKQLMEGLEYCHKKNFLH RDIKCSNILLNNSGQIKLADFGLARLYNSEESRPYTNKVITLWYRPPELL LGEERYTPAIDVWSCGCILGELFTKKPIFQANLELAQLELISRLCGSPCP AVWPDVIKLPYFNTMKPKKQYRRRLREEFSFIPSAALDLLDHMLTLDPSK RCTAEQTLQSDFLKDVELSKMAPPDLPHWQDCHELWSKKRRRQRQSGVVV EEPPPSKTSRKETTSGTSTEPVKNSSPAPPQPAPGKVESGAGDAIGLADI TQQLNQSELAVLLNLLQSQTDLSIPQMAQLLNIHSNPEMQQQLEALNQSI SALTEATSQQQDSETMAPEESLKEAPSAPVILPSAEQTTLEASSTPADMQ NILAVLLSQLMKTQEPAGSLEENNSDKNSGPQGPRRTPTMPQEEAAACPP HILPPEKRPPEPPGPPPPPPPPPLVEGDLSSAPQELNPAVTAALLQLLSQ PEAEPPGHLPHEHQALRPMEYSTRPRPNRTYGNTDGPETGFSAIDTDERN SGPALTESLVQTLVKNRTFSGSLSHLGESSSYQGTGSVQFPGDQDLRFAR VPLALHPVVGQPFLKAEGSSNSVVHAETKLQNYGELGPGTTGASSSGAGL HWGGPTQSSAYGKLYRGPTRVPPRGGRGRGVPY
    • Molecular weight

      135 kDa including tags
    • Amino acids

      658 to 1490
    • Tags

      GST tag N-Terminus
    • Additional sequence information

      NM_016507.

Specifications

Our Abpromise guarantee covers the use of ab204102 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

  • Purity

    > 70 % Densitometry.

  • Form

    Liquid
  • Additional notes

    Protein previously labeled as CrkRS.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 7.5
    Constituents: 0.79% Tris HCl, 0.87% Sodium chloride, 0.31% Glutathione, 0.003% EDTA, 0.004% DTT, 0.002% PMSF, 25% Glycerol

General Info

  • Alternative names

    • arginine/serine-rich
    • Cdc2 related kinase arginine/serine rich
    • CDC2 related protein kinase 7
    • Cdc2-related kinase
    • CDC2-related protein kinase 7
    • Cdk12
    • CDK12_HUMAN
    • Cell division cycle 2 related protein kinase 7
    • Cell division cycle 2-related protein kinase 7
    • Cell division protein kinase 12
    • CRK7
    • CRKR
    • CrkRS
    • Cyclin-dependent kinase 12
    • EC 2.7.11.22
    • hCDK12
    • kiaa0904
    • Pksc
    see all
  • Function

    Cyclin-dependent kinase that phosphorylates the C-terminal domain (CTD) of the large subunit of RNA polymerase II (POLR2A), thereby acting as a key regulator of transcription elongation. Regulates the expression of genes involved in DNA repair and is required for the maintenance of genomic stability. Preferentially phosphorylates 'Ser-5' in CTD repeats that are already phosphorylated at 'Ser-7', but can also phosphorylate 'Ser-2'. Required for RNA splicing, possibly by phosphorylating SRSF1/SF2. Involved in regulation of MAP kinase activity, possibly leading to affect the response to estrogen inhibitors.
  • Tissue specificity

    Ubiquitously expressed.
  • Involvement in disease

    Chromosomal aberrations involving CDK12 may be a cause gastric cancer. Deletions within 17q12 region producing fusion transcripts with ERBB2, leading to CDK12-ERBB2 fusion leading to trunctated CDK12 protein not in-frame with ERBB2.
  • Sequence similarities

    Belongs to the protein kinase superfamily. CMGC Ser/Thr protein kinase family. CDC2/CDKX subfamily.
    Contains 1 protein kinase domain.
  • Post-translational
    modifications

    Phosphorylation at Thr-893 increases kinase activity.
  • Cellular localization

    Nucleus. Nucleus speckle. Colocalized with nuclear speckles throughout interphase.
  • Information by UniProt

Images

  • SDS-PAGE analysis of ab204102.

References

ab204102 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab204102.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up