Recombinant Human CDK13 + CyclinK protein (ab204098)

Description

  • Product name

    Recombinant Human CDK13 + CyclinK protein
  • Purity

    > 70 % Densitometry.

  • Expression system

    Baculovirus infected Sf9 cells
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Amino Acid Sequence 1

    • Species

      Human
    • Sequence

      KKIKIEHAPSPSSGGTLKNDKAKTKPPLQVTKVENNLIVDKATKKAVIVG KESKSAATKEESVSLKEKTKPLTPSIGAKEKEQHVALVTSTLPPLPLPPM LPEDKEADSLRGNISVKAVKKEVEKKLRCLLADLPLPPELPGGDDLSKSP EEKKTATQLHSKRRPKICGPRYGETKEKDIDWGKRCVDKFDIIGIIGEGT YGQVYKARDKDTGEMVALKKVRLDNEKEGFPITAIREIKILRQLTHQSII NMKEIVTDKEDALDFKKDKGAFYLVFEYMDHDLMGLLESGLVHFNENHIK SFMRQLMEGLDYCHKKNFLHRDIKCSNILLNNRGQIKLADFGLARLYSSE ESRPYTNKVITLWYRPPELLLGEERYTPAIDVWSCGCILGELFTKKPIFQ ANQELAQLELISRICGSPCPAVWPDVIKLPYFNTMKPKKQYRRKLREEFV FIPAAALDLFDYMLALDPSKRCTAEQALQCEFLRDVEPSKMPPPDLPLWQ DCHELWSKKRRRQKQMGMTDDVSTIKAPRKDLSLGLDDSRTNTPQGVLPS SQLKSQGSSNVAPVKTGPGQHLNHSELAILLNLLQSKTSVNMADFVQVLN IKVNSETQQQLNKINLPAGILATGEKQTDPSTPQQESSKPLGGIQPSSQT IQPKVETDAAQAAVQSAFAVLLTQLIKAQQSKQKDVLLEERENGSGHEAS LQLRPPPEPSTPVSGQDDLIQHQDMRILELTPEPDRPRILPPDQRPPEPP EPPPVTEEDLDYRTENQHVPTTSSSLTDPHAGVKAALLQLLAQHQPQDDP KREGGIDYQAGDTYVSTSDYKDNFGSSSFSSAPYVSNDGLGSSSAPPLER RSFIGNSDIQSLDNYSTASSHSGGPPQPSAFSESFPSSVAGYGDIYLNAG PMLFSGDKDHRFEYSHGPIAVLANSSDPSTGPESTHPLPAKMHNYNYGGN LQENPSGPSLMHGQTWTSPAQGPGYSQGYRGHISTSTGRGRGRGLPY
    • Predicted molecular weight

      160 kDa including tags
    • Amino acids

      516 to 1512
    • Tags

      GST tag N-Terminus
    • Amino Acid Sequence 2

    • Species

      Human
    • Sequence

      MKENKENSSPSVTSANLDHTKPCWYWDKKDLAHTPSQLEGLDPATEARYR REGARFIFDVGTRLGLHYDTLATGIIYFHRFYMFHSFKQFPRYVTGACCL FLAGKVEETPKKCKDIIKTARSLLNDVQFGQFGDDPKEEVMVLERILLQT IKFDLQVEHPYQFLLKYAKQLKGDKNKIQKLVQMAWTFVNDSLCTTLSLQ WEPEIIAVAVMYLAGRLCKFEIQEWTSKPMYRRWWEQFVQDVPVDVLEDI CHQILDLYSQGKQQMPHHTPHQLQQPPSLQPTPQVPQVQQSQPSQSSEPS QPQQKDPQQPAQQQQPAQQPKKPSPQPSSPRQVKRAVVVSPKEENKAAEP PPPKIPKIETTHPPLPPAHPPPDRKPPLAAALGEAEPPGPVDATDLPKVQ IPPPAHPAPVHQPPPLPHRPPPPPPSSYMTGMSTTSSYMSGEGYQSLQSM MKTEGPSYGALPPAYGPPAHLPYHPHVYPPNPPPPPVPPPPASFPPPAIP PPTPGYPPPPPTYNPNFPPPPPRLPPTHAVPPHPPPGLGLPPASYPPPAV PPGGQPPVPPPIPPPGMPPVGGLGRAAWMR
    • Predicted molecular weight

      67 kDa including tags
    • Amino acids

      1 to 580
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab204098 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 7.5
    Constituents: 0.79% Tris HCl, 25% Glycerol, 0.31% Glutathione, 0.004% DTT, 0.003% EDTA, 0.002% PMSF, 0.87% Sodium chloride

General Info

  • Alternative names

    • CCNK
    • CDC2L
    • CDC2L5
    • CDK13
    • CHED
    • CPR4
    • Cyclin-dependent kinase 13
    • Cyclin-K
    • KIAA1791
    see all
  • Relevance

    Cyclin-dependent kinase which displays CTD kinase activity and is required for RNA splicing. Has CTD kinase activity by hyperphosphorylating the C-terminal heptapeptide repeat domain (CTD) of the largest RNA polymerase II subunit RPB1, thereby acting as a key regulator of transcription elongation. Required for RNA splicing, probably by phosphorylating SRSF1/SF2. Required during hematopoiesis. In case of infection by HIV-1 virus, interacts with HIV-1 Tat protein acetylated at 'Lys-50' and 'Lys-51', thereby increasing HIV-1 mRNA splicing and promoting the production of the doubly spliced HIV-1 protein. Cyclin K regulatory subunit of cyclin-dependent kinases that mediates activation of target kinases. Plays a role in transcriptional regulation via its role in regulating the phosphorylation of the C-terminal domain (CTD) of the large subunit of RNA polymerase II
  • Cellular localization

    Nucleus speckle.

Images

  • SDS-PAGE showing ab204098.

References

ab204098 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab204098.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up