Description

  • Product name

    Recombinant human CDK2 + Cyclin A2 protein
    See all CDK2 + Cyclin A2 proteins and peptides
  • Biological activity

    Specific activity 390 pmol/min/µg.

    Kinase buffer containing 1 mM DTT using Histone H1 (0.1 mg/ml) substrate and 20 µM ATP at 30°C for 30 min. The amount of ATP transferred was calculated using Kinase reagents

  • Purity

    >= 64 % SDS-PAGE.

  • Expression system

    Baculovirus infected Sf9 cells
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Amino Acid Sequence 1

    • Species

      Human
    • Sequence

      ENFQKVEKIGEGTYGVVYKARNKLTGEVVALKKIRLDTETEGVPSTAIRE ISLLKELNH PNIVKLLDVIHTENKLYLVFEFLHQDLKKFMDASALTGI PLPLIKSYLFQLLQGLAFCHS HRVLHRDLKPQNLLINTEGAIKLADFG LARAFGVPVRTYTHEVVTLWYRAPEILLGCKYY STAVDIWSLGCIFAE MVTRRALFPGDSEIDQLFRIFRTLGTPDEVVWPGVTSMPDYKPSF PKW ARQDFSKVVPPLDEDGRSLLSQMLHYDPNKRISAKAALAHPFFQDVTKPV PHLRL
    • Predicted molecular weight

      61 kDa including tags
    • Amino acids

      2 to 298
    • Tags

      GST tag N-Terminus
    • Additional sequence information

      (NM_001798)
    • Amino Acid Sequence 2

    • Species

      Human
    • Sequence

      EVPDYHE DIHTYLREME VKCKPKVGYM KKQPDITNSM RAILVDWLVE VGEEYKLQNE TLHLAVNYID RFLSSMSVLR GKLQLVGTAA MLLASKFEEI YPPEVAEFVY ITDDTYTKKQ VLRMEHLVLK VLTFDLAAPT VNQFLTQYFL HQQPANCKVE SLAMFLGELS LIDADPYLKY LPSVIAGAAF HLALYTVTGQ SWPESLIRKT GYTLESLKPC LMDLHQTYLK APQHAQQSIR EKYKNSKYHG VSLLNPPETL NL
    • Predicted molecular weight

      34 kDa including tags
    • Amino acids

      174 to 432
    • Tags

      His tag N-Terminus , GST tag N-Terminus
    • Additional sequence information

      Cyclin A2 (NM_001237)

Specifications

Our Abpromise guarantee covers the use of ab196060 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Functional Studies

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 7.50
    Constituents: 0.79% Tris HCl, 0.87% Sodium chloride, 0.004% DTT, 0.004% EGTA, 0.003% EDTA, 0.002% PMSF, 25% Glycerol

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names

    • CCN1
    • CCNA
    • Cell division protein kinase 2
    • Cyclin A
    • Cyclin A2
    • Cyclin dependent kinase 2
    • p33 protein kinase
    see all
  • Relevance

    CDK2 is a member of the Ser/Thr protein kinase family. This protein kinase is highly similar to the gene products of S. cerevisiae cdc28, and S. pombe cdc2. It is a catalytic subunit of the cyclin-dependent protein kinase complex, whose activity is restricted to the G1-S phase, and essential for cell cycle G1/S phase transition. This protein associates with and regulated by the regulatory subunits of the complex including cyclin A or E, CDK inhibitor p21Cip1 (CDKN1A) and p27Kip1 (CDKN1B). Its activity is also regulated by its protein phosphorylation. Cyclin A2 belongs to the highly conserved cyclin family, whose members are characterized by a dramatic periodicity in protein abundance through the cell cycle. Cyclins function as regulators of CDK kinases. Different cyclins exhibit distinct expression and degradation patterns which contribute to the temporal coordination of each mitotic event. In contrast to cyclin A1, which is present only in germ cells, this cyclin is expressed in all tissues tested. This cyclin binds and activates CDC2 or CDK2 kinases, and thus promotes both cell cycle G1/S and G2/M transitions.
  • Cellular localization

    Nuclear

Images

  • SDS-PAGE analysis of ab196060 on 10% SDS-PAGE gel and stained with Coomassie blue (top band Cyclin A2; bottom band: Cdk2).

  • Specific activity of ab196060

References

ab196060 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab196060.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up