Overview

Description

  • Nature

    Recombinant
  • Source

    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMGSHMQKYEKLEKIGEGTYGTVFKAKNRET HEIVALKRVRLDDDDEGVPSSALREICLLKELKHKNIVRLHDVLHSDKKL TLVFEFCDQDLKKYFDSCNGDLDPEIVKSFLFQLLKGLGFCHSRNVLHRD LKPQNLLINRNGELKLADFGLARAFGIPVRCYSAEVVTLWYRPPDVLFGA KLYSTSIDMWSAGCIFAELANAGRPLFPGNDVDDQLKRIFRLLGTPTEEQ WPSMTKLPDYKPYPMYPATTSLVNVVPKLNATGRDLLQNLLKCNPVQRIS AEEALQHPYFSDFCPP
    • Molecular weight

      36 kDa including tags
    • Amino acids

      1 to 292
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab137142 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity

    > 85 % SDS-PAGE.

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 2.4% Urea, 0.32% Tris HCl, 10% Glycerol

General Info

  • Alternative names

    • Cdk 5
    • Cdk5
    • CDK5_HUMAN
    • Cell division protein kinase 5
    • Crk6
    • Cyclin dependent kinase 5
    • Cyclin-dependent kinase 5
    • Protein kinase CDK5 splicing
    • PSSALRE
    • Serine threonine protein kinase PSSALRE
    • Serine/threonine-protein kinase PSSALRE
    • Tau protein kinase II catalytic subunit
    • TPKII catalytic subunit
    see all
  • Function

    Probably involved in the control of the cell cycle. Interacts with D1 and D3-type G1 cyclins. Can phosphorylate histone H1, tau, MAP2 and NF-H and NF-M. Also interacts with p35 which activates the kinase.
  • Sequence similarities

    Belongs to the protein kinase superfamily. CMGC Ser/Thr protein kinase family. CDC2/CDKX subfamily.
    Contains 1 protein kinase domain.
  • Cellular localization

    Cytoplasm. Cell projection > lamellipodium. Cell projection > growth cone. In axonal growth cone with extension to the peripheral lamellipodia.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3 µg ab137142.

References

ab137142 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab137142.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up