Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MEDHQHVPIDIQTSKLLDWLVDRRHCSLKWQSLVLTIREKINAAIQDMPE SEEIAQLLSGSYIHYFHCLRILDLLKGTEASTKNIFGRYSSQRMKDWQEI IALYEKDNTYLVELSSLLVRNVNYEIPSLKKQIAKCQQLQQEYSRKEEEC QAGAAEMREQFYHSCKQYGITGENVRGELLALVKDLPSQLAEIGAAAQQS LGEAIDVYQASVGFVCESPTEQVLPMLRFVQKRGNSTVYEWRTGTEPSVV ERPHLEELPEQVAEDAIDWGDFGVEAVSEGTDSGISAEAAGIDWGIFPES DSKDPGGDGIDWGDDAVALQITVLEAGTQAPEGVARGPDALTLLEYTETR NQFLDELMELEIFLAQRAVELSEEADVLSVSQFQLAPAILQGQTKEKMVT MVSVLEDLIGKLTSLQLQHLFMILASPRYVDRVTEFLQQKLKQSQLLALK KELMVQKQQEALEEQAALEPKLDLLLEKTKELQKLIEADISKRYSGRPVN LMGTSL
    • Amino acids
      1 to 506
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab164242 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • C53
    • CDK5 activator binding protein C53
    • CDK5 activator-binding protein C53
    • CDK5 regulatory subunit associated protein 3
    • CDK5 regulatory subunit-associated protein 3
    • Cdk5rap3
    • CK5P3_HUMAN
    • HSF 27
    • HSF27
    • IC53
    • Ischemic heart CDK5 activator binding protein C53
    • LXXLL/leucine zipper containing ARFbinding protein
    • LZAP
    • MST016
    • OK/SW cl.114
    • PP1553
    • Protein HSF-27
    see all
  • Function
    Potential regulator of CDK5 activity. May be involved in cell proliferation. Regulates CDK5 activity via its interaction with CDK5R1.
  • Tissue specificity
    Ubiquitous. Expressed in heart, brain, placenta, lung, liver, skeletal muscle, kidney and pancreas. Isoform 3 is expressed in kidney, liver, skeletal muscle and placenta.
  • Sequence similarities
    Belongs to the CDK5RAP3 family.
  • Post-translational
    modifications
    Phosphorylated in vitro by CDK5.
  • Information by UniProt

Images

  • ab164242 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab164242 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab164242.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up