Overview

  • Product name

    Recombinant Human CDKAL1 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MPSASCDTLLDDIEDIVSQEDSKPQDRHFVRKDVVPKVRRRNTQKYLQEE ENSPPSDSTIPGIQKIWIRTWGCSHNNSDGEYMAGQLAAYGYKITGE
    • Molecular weight

      37 kDa including tags
    • Amino acids

      1 to 97

Specifications

Our Abpromise guarantee covers the use of ab132667 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

    SDS-PAGE

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml. Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • CDK5 regulatory subunit associated protein 1 like 1
    • CDK5 regulatory subunit-associated protein 1-like 1
    • CDKAL_HUMAN
    • CDKAL1
    • Threonylcarbamoyladenosine tRNA methylthiotransferase
    • tRNA t 6 A37 methylthiotransferase
    • tRNA-t(6)A37 methylthiotransferase
    see all
  • Function

    Catalyzes the methylthiolation of N6-threonylcarbamoyladenosine (t(6)A), leading to the formation of 2-methylthio-N6-threonylcarbamoyladenosine (ms(2)t(6)A) at position 37 in tRNAs that read codons beginning with adenine.
  • Tissue specificity

    Expressed in pancreatic islets.
  • Involvement in disease

    Genetic variations in CDKAL1 are a cause of susceptibility to diabetes mellitus, non-insulin-dependent (NIDDM) [MIM:125853]. A multifactorial disorder of glucose homeostasis caused by a lack of sensitivity to the body's own insulin. Affected individuals usually have an obese body habitus and manifestations of a metabolic syndrome characterized by diabetes, insulin resistance, hypertension and hypertriglyceridemia. The disease results in long-term complications that affect the eyes, kidneys, nerves, and blood vessels.
  • Sequence similarities

    Belongs to the methylthiotransferase family. CDKAL1 subfamily.
    Contains 1 MTTase N-terminal domain.
    Contains 1 TRAM domain.
  • Cellular localization

    Endoplasmic reticulum membrane. Is a tail-anchored protein that exploits the TCR40 pathway for insertion into the endoplasmic reticulum.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab132667 stained with Coomassie Blue

References

ab132667 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132667.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up