Description

  • Product name

    Recombinant Human CDKN2AIPNL protein
  • Purity

    > 85 % SDS-PAGE.
    Purified by using conventional chromatography techniques.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMGSMVGGEAAAAVEELVSGVRQAADFAEQF RSYSESEKQWKARMEFILRHLPDYRDPPDGSGRLDQLLSLSMVWANHLFL GCSYNKDLLDKVMEMADGIEVEDLPQFTTRSELMKKHQS
    • Predicted molecular weight

      16 kDa including tags
    • Amino acids

      1 to 116
    • Tags

      His tag N-Terminus
    • Additional sequence information

      NP_542387

Specifications

Our Abpromise guarantee covers the use of ab177647 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry

    MALDI-TOF
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Information available upon request.

General Info

  • Alternative names

    • C2AIL
    • C2AIL_HUMAN
    • CDKN2A interacting protein N terminal like
    • CDKN2A interacting protein N terminal like protein
    • CDKN2A-interacting protein N-terminal-like protein
    • CDKN2AIP N terminal like protein
    • CDKN2AIP N-terminal-like protein
    • Cdkn2aipnl
    see all
  • Sequence similarities

    Belongs to the CARF family.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of ab177647 (3µg).

References

ab177647 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab177647.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up