Description

  • Product name

    Recombinant Human CDKN2A/p16INK4a protein (Tagged)
    See all CDKN2A/p16INK4a proteins and peptides
  • Purity

    > 95 % SDS-PAGE.
    >95% by HPLC analysis.
  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      EPAAGSSMEPSADWLATAAARGRVEEVRALLEAGALPNAPNSYGRRPIQV MMMGSARVAELLLLHGAEPNCADPATLTRPVHDAAREGFLDTLVVLHRAG ARLDVRDAWGRLPVDLAEELGHRDVARYLRAAAGGTRGSNHARIDAAEGP SDIPDGYGRKKRRQRRR
    • Predicted molecular weight

      18 kDa including tags
    • Amino acids

      2 to 156
    • Additional sequence information

      12-residue C-terminal TAT peptide (GYGRKKRRQRRR) tag.

Specifications

Our Abpromise guarantee covers the use of ab216254 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    HPLC

    SDS-PAGE

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Store at -20°C. Avoid freeze / thaw cycle.

    pH: 7.2
    Constituents: PBS, 0.02% DTT

  • Reconstitution
    Centrifuge the vial prior to opening. Reconstitute in PBS, pH 8.0 to a concentration of 0.1-1.0 mg/m. Do not vortex. For extended storage, it is recommended to further dilute in a buffer containing a carrier protein (example 0.1% BSA) and store in working aliquots at -20°C to -80°C. The lyophilized protein is stable at room temperature for 1 month and at 4°C for 6 months. Reconstituted working aliquots are stable for 1 week at 2°C to 8°C and for 3 months at -20°C to -80°C.

General Info

  • Alternative names

    • CCM2
    • CDK4 inhibitor p16 INK4
    • CDK4I
    • CDKN2
    • CDKN2A
    • Cell cycle negative regulator beta
    • CMM2
    • Cyclin dependent kinase 4 inhibitor A
    • Cyclin Dependent Kinase Inhibitor 2A
    • Cyclin dependent kinase inhibitor 2A (melanoma p16 inhibits CDK4)
    • Cyclin dependent kinase inhibitor 2A isoform 4
    • Cyclin dependent kinase inhibitor 2A isoforms 1/2/3
    • Cyclin dependent kinase inhibitor p16
    • INK4
    • INK4A
    • MLM
    • MTS1
    • Multiple tumor suppressor 1
    • p14
    • p16
    • P16INK4
    • p16INK4a
    • p19
    • p19Arf
    • TP16
    see all
  • Cellular localization

    Cytoplasmic and Nuclear

References

ab216254 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab216254.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up