Description

  • Product name

    Recombinant Human CDNF protein
    See all CDNF proteins and peptides
  • Purity

    > 95 % SDS-PAGE.
    Purity is greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    Mammalian
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      QGQEAGGRPGADCEVCKEFLNRFYKSLIDRGVNFSLDTIEKELISFCLDT KGKENRLCYYLGATKDAATKILSEVTRPMSVHMPAMKICEKLKKLDSQIC ELKYEKTLDLASVDLRKMRVAELKQILHSWGEECRACAEKTDYVNLIQEL APKYAATHPKTELHHHHHH
    • Predicted molecular weight

      19 kDa including tags
    • Amino acids

      25 to 187
    • Tags

      His tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab185829 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    HPLC

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. The lyophilized protein is stable for a few weeks at room temperature. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 7.4
    Constituents: 0.88% Sodium chloride, 99% Phosphate Buffer

  • Reconstitution
    Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 3X PBS. After reconstitution aliquot and store at < -20°C, avoid freeze/thaw cycles.

General Info

  • Alternative names

    • Arginine rich mutated in early stage tumors like 1
    • ARMET L1
    • ARMET like protein 1
    • ARMET-like protein 1
    • ARMETL 1
    • ARMETL1
    • CDNF
    • CDNF_HUMAN
    • Cerebral dopamine neurotrophic factor
    • Conserved dopamine neurotrophic factor
    see all
  • Function

    Trophic factor for dopamine neurons. Prevents the 6-hydroxydopamine (6-OHDA)-induced degeneration of dopaminergic neurons. When administered after 6-OHDA-lesioning, restores the dopaminergic function and prevents the degeneration of dopaminergic neurons in substantia nigra.
  • Tissue specificity

    Widely expressed in neuronal and non-neuronal tissues. In the brain, highest levels in the optic nerve and corpus callosum.
  • Sequence similarities

    Belongs to the ARMET family.
  • Cellular localization

    Secreted.
  • Information by UniProt

References

ab185829 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab185829.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up