Overview

Description

  • Nature

    Recombinant
  • Source

    CHO cells
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      QGQEAGGRPGADCEVCKEFLNRFYKSLIDRGVNFSLDTIEKELISFCLDT KGKENRLCYYLGATKDAATKILSEVTRPMSVHMPAMKICEKLKKLDSQIC ELKYEKTLDLASVDLRKMRVAELKQILHSWGEECRACAEKTDYVNLIQEL APKYAATHPKTEL
    • Molecular weight

      19 kDa
    • Amino acids

      25 to 187
    • Additional sequence information

      This product is for the mature full length protein. The signal peptide is not included.

Specifications

Our Abpromise guarantee covers the use of ab206463 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity

    Protein is biologically active. Suitable for cell culture and in vivo testing. Biological activity of ab206463 was tested in rat 6-OHDA model of Parkinson’s disease and shown to be both neuroprotective and neurorestorative.

  • Applications

    Mass Spectrometry

    Functional Studies

    SDS-PAGE

  • Endotoxin level

    < 1.000 Eu/mg
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle.

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names

    • Arginine rich mutated in early stage tumors like 1
    • ARMET L1
    • ARMET like protein 1
    • ARMET-like protein 1
    • ARMETL 1
    • ARMETL1
    • CDNF
    • CDNF_HUMAN
    • Cerebral dopamine neurotrophic factor
    • Conserved dopamine neurotrophic factor
    see all
  • Function

    Trophic factor for dopamine neurons. Prevents the 6-hydroxydopamine (6-OHDA)-induced degeneration of dopaminergic neurons. When administered after 6-OHDA-lesioning, restores the dopaminergic function and prevents the degeneration of dopaminergic neurons in substantia nigra.
  • Tissue specificity

    Widely expressed in neuronal and non-neuronal tissues. In the brain, highest levels in the optic nerve and corpus callosum.
  • Sequence similarities

    Belongs to the ARMET family.
  • Cellular localization

    Secreted.
  • Information by UniProt

Images

  • Anti-CDNF polyclonal antibody + ab206463 expressed into the supernatant of CHO cell culture medium
  • SDS-PAGE analysis of ab206463 (4 μg).

References

ab206463 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab206463.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up