Recombinant Human CDY1 protein (ab198453)

Description

  • Product name

    Recombinant Human CDY1 protein
  • Purity

    >= 95 % SDS-PAGE.

  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MHHHHHHASQEFEVEAIVDKRQDKNGNTQYLVRWKGYDKQDDTWEPEQHL MNCEKCVHDFNRRQTEKQKKLTWTTTSRIFSNNARRRTSRSTKANY
    • Predicted molecular weight

      12 kDa including tags
    • Amino acids

      2 to 90
    • Tags

      His tag N-Terminus
    • Additional sequence information

      NM_170723.

Specifications

Our Abpromise guarantee covers the use of ab198453 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Preservative: 2.04% Imidazole
    Constituents: 0.63% Tris HCl, 20% Glycerol, 0.64% Sodium chloride, 0.04% Tween, 0.02% Potassium chloride

General Info

  • Alternative names

    • CDY
    • CDY1
    • CDY1_HUMAN
    • CDY1B
    • Chromodomain protein Y chromosome 1 centromeric
    • Chromodomain protein Y linked 1B
    • Testis specific chromodomain protein on Y centromeric
    • Testis-specific chromodomain protein Y 1
    see all
  • Function

    Has histone acetyltransferase activity, with a preference for histone H4.
  • Tissue specificity

    Testis-specific. Detected in spermatids (at protein level).
  • Sequence similarities

    Contains 1 chromo domain.
  • Cellular localization

    Nucleus.
  • Information by UniProt

Images

  • 4-20% SDS-PAGE analysis of 2 μg ab198453 with Coomassie staining.

References

ab198453 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab198453.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up