Overview

  • Product name

    Recombinant Human CDYL protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MDALTANGTTNIQTSVTGVTASKRKFIDDRRDQPFDKRLRFSVRQTESAY RYRDIVVRKQDGFTHILLSTKSSENNSLNPEVMREVQSALSTAAADDSKL VLLSAVGSVFCCGLDFIYFIRRLTDDRKRESTKMAEAIRNFVNTFIQFKK PIIVAVNGPAIGLGASILPLCDVVWANEKAWFQTPYTTFGQSPDGCSTVM FPKIMGGASANEMLLSGRKLTAQEACGKGLVSQVFWPGTFTQEVMVRIKE LASCNPVVLEESKALVRCNMKMELEQANERECEVLKKIWGSAQGMDSMLK YLQRKIDEF
    • Molecular weight

      61 kDa including tags
    • Amino acids

      1 to 309

Associated products

Specifications

Our Abpromise guarantee covers the use of ab131941 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 µg/µl.
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • CDY-like
    • CDY-like autosomal
    • Cdyl
    • CDYL: chromodomain protein Y-like
    • CDYL1
    • CDYL1_HUMAN
    • chromodomain protein Y chromosome-like 6
    • Chromodomain protein Y like
    • Chromodomain Y-like protein
    • DKFZP586C1622
    • MGC131936
    • OTTHUMP00000015984
    • OTTHUMP00000211185
    • OTTHUMP00000211186
    • OTTHUMP00000211189
    • testis-specific chromodomain Y-like protein
    • Weakly similar to enoyl-CoA hydratase [H.sapiens]
    see all
  • Function

    Acts as repressor of transcription (By similarity). Has histone acetyltransferase activity, with a preference for histone H4.
  • Tissue specificity

    Ubiquitous. Expressed at moderate levels in all tissues examined.
  • Sequence similarities

    Contains 1 chromo domain.
  • Cellular localization

    Nucleus.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE showing ab131941 at approximately 61 kDa.
    Stained with Coomassie Blue.

References

ab131941 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab131941.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up