Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGHLSAPLHRVRVPWQGLLLTASLLTFWNPPTTAQLTTESMPFNVAEGKE VLLLVHNLPQQLFGYSWYKGERVDGNRQIVGYAIGTQQATPGPANSGRET IYPNASLLIQNVTQNDTGFYTLQVIKSDLVNEEATGQFHVYPELPKPSIS SNNSNPVEDKDAVAFTCEPETQDTTYLWWINNQSLPVSPRLQLSNGNRTL TLLSVTRNDTGPYECEIQNPVSANRSDPVTLNVTYGPDTPTISPSDTYYR PGANLSLSCYAASNPPAQYSWLINGTFQQSTQELFIPNITVNNSGSYTCH ANNSVTGCNRTTVKTIIVTELSPVVAKPQIKASKTTVTGDKDSVNLTCST NDTGISIRWFFKNQSLPSSERMKLSQGNTTLSINPVKREDAGTYWCEVFN PISKNQSDPIMLNVNYNALPQENGLSPGAIAGIVIGVVALVALIAVALAC FLHFGKTGRTTPMTHLTR
    • Molecular weight
      77 kDa including tags
    • Amino acids
      1 to 468

Associated products

Specifications

Our Abpromise guarantee covers the use of ab132970 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

    SDS-PAGE

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 µg/µl.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Antigen CD66
    • BGP
    • BGP 1
    • BGP-1
    • BGPI
    • Biliary glycoprotein
    • Biliary glycoprotein 1
    • Biliary glycoprotein adhesion molecule
    • Carcinoembryonic antigen related cell adhesion molecule 1
    • Carcinoembryonic antigen-related cell adhesion molecule 1
    • carcinoembryonic antigen-related cell adhesion molecule 1 (biliary glycoprotein)
    • CD66a
    • CD66a antigen
    • CEACAM1
    • CEAM1_HUMAN
    • meconium antigen 100
    see all
  • Sequence similarities
    Belongs to the immunoglobulin superfamily. CEA family.
    Contains 3 Ig-like C2-type (immunoglobulin-like) domains.
    Contains 1 Ig-like V-type (immunoglobulin-like) domain.
  • Cellular localization
    Secreted; Cell membrane and Cell membrane. Localizes to sites of cell-cell contact.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab132970 stained with Coomassie Blue.

References

ab132970 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132970.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up