Overview

Description

  • Nature
    Recombinant
  • Source
    HEK 293 cells
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      QLTTESMPFNVAEGKEVLLLVHNLPQQLFGYSWYKGERVDGNRQIVGYAI GTQQATPGPANSGRETIYPNASLLIQNVTQNDTGFYTLQVIKSDLVNEEA TGQFHVYPELPKPSISSNNSNPVEDKDAVAFTCEPETQDTTYLWWINNQS LPVSPRLQLSNGNRTLTLLSVTRNDTGPYECEIQNPVSANRSDPVTLNVT YGPDTPTISPSDTYYRPGANLSLSCYAASNPPAQYSWLINGTFQQSTQEL FIPNITVNNSGSYTCHANNSVTGCNRTTVKTIIVTELSPVVAKPQIKASK TTVTGDKDSVNLTCSTNDTGISIRWFFKNQSLPSSERMKLSQGNTTLSIN PVKREDAGTYWCEVFNPISKNQSDPIMLNVNYNALPQENGLSPG
    • Molecular weight
      46 kDa including tags
    • Amino acids
      35 to 428
    • Tags
      His tag C-Terminus , Avi tag C-Terminus
    • Additional sequence information
      Extracellular domain. AviTag sequence GLNDIFEAQKIEWHE.
  • Conjugation
    Biotin

Specifications

Our Abpromise guarantee covers the use of ab246086 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Endotoxin level
    < 1.000 Eu/µg
  • Purity
    >95% by SDS-PAGE .
    The biotin to protein ratio is 0.5-1 as determined by the HABA assay.
  • Form
    Lyophilised
  • Additional notes

    Biotinylation of this product is performed using Avitag™ technology. Briefly, the single lysine residue in the Avitag is enzymatically labeled with biotin.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon reconsitution add a carrier protein (0.1% BSA). Store at -20°C or -80°C. Avoid freeze / thaw cycle. Store In the Dark.

    pH: 7.40
    Constituents: PBS, 5% Trehalose

    0.22 µm filtered

  • Reconstitution
    It is recommended to reconstitute the lyophilized product in sterile deionized water to a final concentration of 1 mg/ml. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long-term storage.

General Info

  • Alternative names
    • Antigen CD66
    • BGP
    • BGP 1
    • BGP-1
    • BGPI
    • Biliary glycoprotein
    • Biliary glycoprotein 1
    • Biliary glycoprotein adhesion molecule
    • Carcinoembryonic antigen related cell adhesion molecule 1
    • Carcinoembryonic antigen-related cell adhesion molecule 1
    • carcinoembryonic antigen-related cell adhesion molecule 1 (biliary glycoprotein)
    • CD66a
    • CD66a antigen
    • CEACAM1
    • CEAM1_HUMAN
    • meconium antigen 100
    see all
  • Sequence similarities
    Belongs to the immunoglobulin superfamily. CEA family.
    Contains 3 Ig-like C2-type (immunoglobulin-like) domains.
    Contains 1 Ig-like V-type (immunoglobulin-like) domain.
  • Cellular localization
    Secreted; Cell membrane and Cell membrane. Localizes to sites of cell-cell contact.
  • Information by UniProt

Images

  • SDS-PAGE - Human CEACAM1 protein (Tagged) (Biotin) (ab246086).

    The gel was stained overnight with Coomassie Blue.

    The protein migrates as 66-115 kDa under reducing conditions due to glycosylation.

References

ab246086 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab246086.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up