Description

  • Product name

    Recombinant Human CEACAM6 protein
    See all CEACAM6 proteins and peptides
  • Expression system

    Wheat germ
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      PVEDKDAVAFTCEPEVQNTTYLWWVNGQSLPVSPRLQLSN GNMTLTLL SVKRNDAGSYECEIQNPASANRSDPVTLNVLY GPDVPTISPSKANYRP GENLNLSCHAASNP
    • Predicted molecular weight

      38 kDa including tags
    • Amino acids

      156 to 265

Specifications

Our Abpromise guarantee covers the use of ab114904 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml. Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Carcinoembryonic antigen related cell adhesion molecule 6
    • Carcinoembryonic antigen related cell adhesion molecule 6 (non specific cross reacting antigen)
    • Carcinoembryonic antigen-related cell adhesion molecule 6
    • CD 66c
    • CD66c
    • CD66c antigen
    • CEA LIKE PROTEIN
    • CEACAM 6
    • CEACAM6
    • CEAL
    • CEAM6_HUMAN
    • MGC93832
    • NCA
    • Non specific cross reacting antigen
    • Non-specific crossreacting antigen
    • Normal cross reacting antigen
    • Normal cross-reacting antigen
    see all
  • Sequence similarities

    Belongs to the immunoglobulin superfamily. CEA family.
    Contains 2 Ig-like C2-type (immunoglobulin-like) domains.
    Contains 1 Ig-like V-type (immunoglobulin-like) domain.
  • Cellular localization

    Cell membrane.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE showing ab114904 at approximately 37.73kDa.
    Stained with Coomassie Blue.

References

ab114904 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab114904.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up