Overview

  • Product name

    Recombinant Human CEACAM7 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      TNIDVVPFNVAEGKEVLLVVHNESQNLYGYNWYKGERVHANYRIIGYVKN ISQENAPGPAHNGRETIYPNGTLLIQNVTHNDAGIYTLHVIKENLVNEEV TRQFYVFSEPPKPSITSNNFNPVENKDIVVLTCQPETQNTTYLWWVNNQS LLVSPRLLLSTDNRTLVLLSATKNDIGPYECEIQNPVGASRSDPVTLNVR YESVQAS
    • Molecular weight

      26 kDa including tags
    • Amino acids

      36 to 242
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab156717 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity

    > 85 % SDS-PAGE.

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.32% Tris HCl, 10% Glycerol, 0.88% Sodium chloride

General Info

  • Alternative names

    • Carcinoembryonic antigen CGM 2
    • Carcinoembryonic antigen CGM2
    • Carcinoembryonic antigen gene family member 2
    • Carcinoembryonic antigen related cell adhesion molecule 7
    • Carcinoembryonic antigen-related cell adhesion molecule 7
    • CEA
    • CEACAM 7
    • CEACAM7
    • CEAM7_HUMAN
    • CGM 2
    • CGM2
    see all
  • Tissue specificity

    Strongly down-regulated in colonic adenocarcinomas.
  • Sequence similarities

    Belongs to the immunoglobulin superfamily. CEA family.
    Contains 1 Ig-like C2-type (immunoglobulin-like) domain.
    Contains 1 Ig-like V-type (immunoglobulin-like) domain.
  • Cellular localization

    Cell membrane.
  • Information by UniProt

Images

  • SDS-PAGE analysis using ab156717 at 3ug.

References

ab156717 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab156717.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up