Description

  • Product name

    Recombinant human CECR2 protein (Active)
    See all CECR2 proteins and peptides
  • Purity

    > 95 % SDS-PAGE.

  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MHHHHHHTKDLFELDDDFTAMYKVLDVVKAHKDSWPFLEPVDESYAPNYY QIIKAPMDISSMEKKLNGGLYCTKEEFVNDMKTMFRNCRKYNGESSEYTK MSDNLERCFHRAMMKHFPGED
    • Predicted molecular weight

      14 kDa including tags
    • Amino acids

      430 to 543
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab196136 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Functional Studies

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.64% Sodium chloride, 0.02% Potassium chloride, 0.04% Tween, 20% Glycerol, 0.48% Tris

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names

    • Cat eye syndrome chromosome region candidate 2
    • Cat eye syndrome critical region protein 2
    • CECR2
    • CECR2_HUMAN
    • KIAA1740
    see all
  • Function

    Part of the CERF (CECR2-containing-remodeling factor) complex, which facilitates the perturbation of chromatin structure in an ATP-dependent manner. May be involved through its interaction with LRPPRC in the integration of cytoskeletal network with vesicular trafficking, nucleocytosolic shuttling, transcription, chromosome remodeling and cytokinesis.
  • Tissue specificity

    Highly expressed in skeletal muscle, thymus, placenta and lung. Expressed at lower level in brain, heart, colon, spleen, kidney.
  • Sequence similarities

    Contains 1 bromo domain.
  • Information by UniProt

Images

  • Example data obtained using ab196136.

  • 4-20% SDS-PAGE analysis of 3.2 µg ab196136 with Coomassie staining.

References

ab196136 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab196136.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up