Overview

  • Product name
    Recombinant Human CEL2B protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MIRTLLLSTLVAGALSCGVSTYAPDMSRMLGGEEARPNSWPWQVSLQYSS NGQWYHTCGGSLIANSWVLTAAHCISSSGIYRVMLGQHNLYVAESGSLAV SVSKIVVHKDWNSDQVSKGNDIALLKLANPVSLTDKIQLACLPPAGTILP NNYPCYVTGWGRLQTNGALPDDLKQGRLLVVDYATCSSSGWWGSTVKTNM ICAGGDGVICTCNGDSGGPLNCQASDGRWEVHGIGSLTSVLGCNYYYKPS IFTRVSNYNDWINSVIANN
    • Amino acids
      1 to 269
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162399 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CELA2B
    • Chymotrypsin like elastase family, member 2B
    • EC 3.4.21.71
    • ELA2B
    • Elastase 2B
    • MGC142100
    • MGC142102
    • MGC97052
    • Pancreatic elastase IIB (ELA2B)
    • RP11-265F14.2
    see all
  • Relevance
    Elastases form a subfamily of serine proteases that hydrolyze many proteins in addition to elastin. Humans have six elastase genes which encode the structurally similar proteins elastase 1, 2, 2A, 2B, 3A, and 3B. Like most of the Human elastases, CEL2B is secreted from the pancreas as a zymogen. In other species, CEL2B has been shown to preferentially cleave proteins after leucine, methionine, and phenylalanine residues.
  • Cellular localization
    Secreted

Images

  • ab162399 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162399 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162399.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up